KEGG   Treponema succinifaciens: Tresu_1439Help
Entry
Tresu_1439        CDS       T01461                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00010  Glycolysis / Gluconeogenesis
tsu00052  Galactose metabolism
tsu01100  Metabolic pathways
tsu01110  Biosynthesis of secondary metabolites
tsu01120  Microbial metabolism in diverse environments
tsu01130  Biosynthesis of antibiotics
Module
tsu_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tresu_1439
   00052 Galactose metabolism
    Tresu_1439
Enzymes [BR:tsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Tresu_1439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEB14342
UniProt: F2NS41
Position
complement(1544465..1545505)
Genome map
AA seq 346 aa AA seqDB search
MSNLKFKKVKFGTLYDGRKVHLYTVSNGSMSFSAIDYGCTITSILLPAKGGKKVDVLLGC
STLEGYASSGSCFGTVVGRFANRIGGAAFSLNGKTYQLDKNDGENCLHGGFDRYEKKLWS
AKKIRTDKGLGIEFSRISPAGEQNMPGNLKIKVTYTLNEDNELTLDYFAKTDAPTPVNLT
NHAYFNLKGYDGGSIEDQELKMDCSKFVEVDEHLIPSGNLCSVDEKKAFDFRVPKLIGKD
IKETGSGYDHAYCIDSYNGSLVEFAVLKDPASGRTMTVSTTLPACQIYTANFIDGVGKNG
YPLKSHDAVCMETEAYPDAPNHENFPSCIVTPEKLYHETTVYKFGF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttgaaatttaaaaaggtcaaatttggaactctgtatgatggaagaaaagtt
catttgtacacagtttcaaatggctccatgagcttttctgctatagattatggatgcaca
attacaagcattcttttacctgcaaaaggcggaaaaaaagtcgatgttcttttgggctgt
tcaactttggaaggctatgcttctagcggtagctgttttggaactgtagttggtcgcttt
gcaaacagaatcggcggcgctgctttttctctaaatggaaaaacttaccagcttgataaa
aatgacggcgaaaactgtcttcatggcggcttcgaccgttacgaaaagaagctgtggtct
gcaaaaaaaatccgtactgacaaaggtcttggaattgaattttcacgaataagtcctgct
ggcgaacaaaatatgcctggcaatttgaaaataaaagtcacctacacattaaatgaagac
aatgagcttactttggattattttgccaagacagacgctccaactccagtaaaccttacg
aaccatgcttatttcaatttgaaaggctatgatggcggttctattgaagatcaggaactc
aagatggattgctcaaaatttgttgaagttgacgagcatctcattccgtctggaaacctt
tgttctgttgatgaaaaaaaagcttttgactttagagttccaaaacttattggcaaagat
ataaaagaaactggctcgggatatgaccatgcttattgcattgattcatataatggaagt
ttagttgaattcgcggtgttaaaagatcctgccagcggacgcacaatgacagtttctaca
acgttgcctgcctgccagatttatacagcaaattttattgatggagttggaaagaacggc
tatcctttaaaatctcatgacgctgtctgcatggaaactgaggcttatcctgatgctccg
aaccatgagaattttccaagttgcatagtaactccagaaaaactgtaccatgaaactacg
gtttataaatttggtttttag

DBGET integrated database retrieval system