KEGG   Treponema succinifaciens: Tresu_1792Help
Entry
Tresu_1792        CDS       T01461                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tsu  Treponema succinifaciens
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tresu_1792
  Lipid metabolism
   00600 Sphingolipid metabolism
    Tresu_1792
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Tresu_1792
Enzymes [BR:tsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Tresu_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1918263..1920647
Genome map
AA seq 794 aa AA seqDB search
MKDRIYFNNGWEFSPSFNEKMLDSKYKGKFEQVRIPHSVCETPFNGFDESEYQKLSIYRK
FFKTEKEWAGKKILLTIEGAAHQCDVFLNGKFLARHSCGYTAFTVDLTDSLLPAGRNNLL
ALKLDSRESLNIPPFGFVIDYMTYGGIYRDVYLDIKNPIYIEDIFIKTKASHFETEITLN
SSDAEGYSIVQRVESSSSVVAQINTGVPGNKILTAADAQPVHPWTLEQPVLYNLVTELIN
PKGKIADKKNVRFGFREIKFDETGFYLNGKKIKLRGLNRHQSYPYVGYAMPKNIQKEDAD
ILKLELGVNYVRTSHYPQSKYFIERCDELGILVFTEFPGWQHIGDDAWKAQALENEDEMI
SQYRNHPSVFMWGVRINESKDDDEFYKATNFLAHKTDSTRPTGGVRCIKNSNLLEDVYTY
NDFSHSGKNAGSLDKIKVTKSHGGYLVTEHSGHMFPTKSFDTEQRRTEHAIRHATVLDSV
AGHDDCAGSSGWCAFDYNTHKEFGSGDRICYHGVMDMFRNPKLAAAVYKSQEDFTGDFIE
VNSNMSIGEYNEGLLGDLWIFTNADSVKLFVNNTFIKEFKASDSPFKNLAHGPILVDDII
GNRLIDEEGISAKNSEKIKELIFAIKKFGQNSLSAKYKLEAAKLFAMRVISKEKLIALFG
KYISNWGGESSSYKFEAIKNGKTVKTLVKSMCKNASLKTQVSRTILIEEETYDVAEVHLR
AEDENGNLQSFIQEAVLAEAEGAIEIIGPQAVSLKGGMSGIYVKTTGTAGRGTLKITDWQ
GKETKISFTVKIKR
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatagaatttattttaacaacggctgggaattttctccgtcattcaatgaaaaa
atgttggattcaaaatacaagggaaaattcgagcaggtaagaattccgcattcagtttgc
gaaactccttttaacggatttgatgaaagcgaatatcaaaagctgagcatttacagaaaa
ttttttaagacagaaaaagaatgggcagggaaaaaaattcttcttacaatagaaggcgcg
gctcatcagtgcgatgtttttttaaacggaaaatttcttgcaaggcacagttgcggatat
acagcttttacagttgacttgacagattctcttttgccggcaggaagaaacaacctgctt
gcattaaaactggacagccgcgagtctttaaacattccgccatttggatttgtaatcgac
tacatgacttacggaggaatctacagagacgtttatcttgatataaaaaatcctatttat
atagaagacatttttataaaaaccaaggcgagccattttgaaacagagataactttgaat
tcttctgacgcggaaggatattcaattgttcagcgagtggaaagttcaagttctgtggtg
gcgcagataaacacaggcgttccgggaaacaaaattcttactgcggcggacgcacagccg
gttcatccgtggactcttgagcagccggttctttacaatcttgttacagaacttataaat
ccaaagggaaaaattgcagacaaaaaaaatgtaagattcggattcagggaaataaaattt
gatgaaaccggattttatctcaatggaaaaaaaataaagcttcgcggactaaacagacat
cagtcatacccttacgtgggatacgcaatgccaaagaatatccagaaagaagatgccgac
attttaaaactcgagcttggcgtaaactacgtaaggacttcgcattatccgcagagcaaa
tattttatagaaagatgcgatgaacttggaattcttgtgttcacggaatttccgggctgg
cagcacattggcgacgatgcctggaaagcgcaggctttggaaaatgaagatgaaatgatt
tcgcagtacagaaatcatccttcagtctttatgtggggtgtaagaataaatgaaagcaag
gacgatgacgaattctacaaggcgacaaatttccttgcgcacaaaacagactcaactcgt
ccaactggcggcgtaagatgcatcaagaacagcaacttgctggaagatgtatatacttac
aacgactttagccattcaggtaaaaacgccggaagccttgataaaatcaaagttacaaaa
agccacggcggatatttagtaacagaacattcaggccatatgttcccgacaaaatcattc
gacactgagcaaagaagaactgagcacgcaataaggcacgccacagttcttgacagcgtt
gcaggacacgatgactgcgcaggctcaagtggctggtgcgccttcgactacaacactcac
aaggaattcggttccggggacagaatttgctaccacggcgtaatggatatgttcagaaat
ccaaagctggcagccgctgtctataaaagccaggaagattttacaggggattttattgaa
gtaaattccaacatgagtatcggagaatacaacgaaggacttttaggcgacctgtggatt
tttacaaacgctgattccgtaaagctttttgtaaacaacacttttataaaggaattcaaa
gcgtctgattcaccgtttaaaaatcttgcgcacggaccgattcttgttgacgacataatc
ggaaacaggctcattgatgaagaaggaatttctgcaaagaacagtgaaaaaataaaagag
ctgatttttgcaataaaaaaattcgggcagaacagtctttctgcaaaatataaactggaa
gccgcaaagctttttgcaatgcgtgttatttcgaaagaaaaactaattgcactctttgga
aaatacataagcaactggggcggagaatcttcttcttataaatttgaagcaataaaaaac
ggcaagactgtaaaaacgcttgtaaagtcaatgtgcaaaaatgcctctttaaaaacgcaa
gtcagccgcacaattttaatagaagaagaaacttacgatgttgcagaagttcatttgcgg
gcagaagacgaaaacggaaaccttcagtcttttatacaggaagctgtacttgcagaagca
gaaggcgcaattgaaataatcggaccacaagcagtttctcttaaaggcggaatgtcagga
atctacgtaaaaacaactggcactgccggaagaggaactttaaaaataactgactggcaa
ggaaaagaaaccaagattagttttactgtaaaaattaaaagatga

DBGET integrated database retrieval system