KEGG   Treponema succinifaciens: Tresu_1807Help
Entry
Tresu_1807        CDS       T01461                                 

Definition
RNA-binding S4 domain-containing protein
Orthology
K06178  
23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
tsu  Treponema succinifaciens
Brite
Enzymes [BR:tsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     Tresu_1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1938195..1938938)
Genome map
AA seq 247 aa AA seqDB search
MPVNNSKEKKEDVMRLQQYMAKCGVASRRASEAIICAGRVTVNGTVVTELGTKVDVQDKV
CVDEKEIHLEEKKCYVLLNKPSGYVCSASDEKGRPVAADLLKEAYSERLYNVGRLDMFSS
GLIIFTNDGDFAAKLSHPSAELEKEYIVDTSLPMPRFLADDFMDGIRIDGVFYRCKDARE
LNSHRMRIVLVEGKNREIRRVFEKYEVGIKSLMRIRIGCVGVGELQFGQFRDLTQDEVKA
LLRLCKN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgttaataattcaaaagagaaaaaagaagacgttatgcgccttcagcagtacatg
gcgaaatgcggtgttgcaagccgccgtgccagcgaagcgattatttgcgctggacgcgtt
accgtaaacggaactgttgtaacagagcttggaactaaagtcgacgtccaagacaaagtc
tgtgttgatgaaaaagaaatccaccttgaagaaaaaaaatgttatgttcttttaaataag
ccttctggatacgtgtgttccgcaagcgatgaaaaaggtcggcctgttgcggcggatttg
ctcaaggaagcttattcggagcgtctttacaatgttggcagacttgatatgttttcaagc
ggccttattatttttacaaacgacggagacttcgccgcaaaactttcacatccttccgcg
gagcttgaaaaagaatacattgtggacacaagccttcctatgccgcgttttcttgcggat
gattttatggacggaatcagaatcgacggagttttctaccgctgcaaagatgcccgcgag
cttaattcacatagaatgagaatcgttcttgttgaaggaaaaaaccgtgaaatccgccgt
gtatttgaaaagtatgaagtgggaataaaaagccttatgcgcataagaattggctgcgtt
ggagttggagaacttcagtttgggcagttcagggatttgactcaagacgaagttaaagcc
cttcttagactttgcaaaaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system