KEGG   Treponema succinifaciens: Tresu_2456Help
Entry
Tresu_2456        CDS       T01461                                 

Definition
(GenBank) 30S ribosomal protein S10
  KO
K02946  
small subunit ribosomal protein S10
Organism
tsu  Treponema succinifaciens
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Tresu_2456
Ribosome [BR:tsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Tresu_2456
  Bacteria
    Tresu_2456
  Archaea
    Tresu_2456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2613932..2614240)
Genome map
AA seq 102 aa AA seqDB search
MANGKIRVRLRAFDVALIDQSAKDIVQQVQKAGAKVSGPIPLPTRINKVTVLRSPFVNKK
SREQFEMRTHKRLIDIFEPSSEVMDSLMKLELPAGVDVEIKQ
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatggcaagattcgtgtaagacttcgtgcttttgacgtagctcttatcgatcag
agcgcaaaagacatcgtgcagcaggttcagaaggcaggagcaaaggtttcaggaccaatc
ccgcttccaacaagaatcaataaagttacagttctccgttcacctttcgttaacaagaag
tcacgtgaacagtttgaaatgagaacccacaaacgccttattgacatttttgaaccaagc
tcagaagtaatggattctttaatgaaacttgaacttccggcaggtgttgatgtagaaatt
aagcagtaa

DBGET integrated database retrieval system