KEGG   Treponema succinifaciens: Tresu_2462Help
Entry
Tresu_2462        CDS       T01461                                 

Definition
(GenBank) 50S ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
tsu  Treponema succinifaciens
Pathway
tsu03010  Ribosome
Module
tsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Tresu_2462
Ribosome [BR:tsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Tresu_2462
  Bacteria
    Tresu_2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N CSTF2_hinge MgtE_N DUF2125
Motif
Other DBs
NCBI-ProteinID: AEB15324
UniProt: F2NTZ2
Position
complement(2625483..2625857)
Genome map
AA seq 124 aa AA seqDB search
MAALTNDEILEAIANMTVQQAADLVKAMEEKFGVSAAAPVAVAAGPAAAAEEEQTEFTVT
LESIDPAKKMDVIKAVKAATGLGLKEAMAIVTGAPQVVKEGVSKADADKLIADITAAGGK
VSKK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcttacaaatgatgaaattcttgaagcaattgcaaacatgacagttcagcag
gcagctgatctcgtaaaggcaatggaagaaaaattcggtgtttctgcggcagcacctgta
gcagtagcagcaggtccagcagcggccgctgaagaagagcagacagaatttactgttact
cttgaatctattgatccagcaaagaaaatggatgttattaaggctgttaaggctgcaaca
ggtcttggtcttaaggaagcaatggcaatcgttactggtgctccacaggttgtaaaagag
ggagtatctaaggctgatgctgacaagctcatcgctgacatcactgctgctggtggaaaa
gttagcaagaaataa

DBGET integrated database retrieval system