KEGG   Treponema succinifaciens: Tresu_2467Help
Entry
Tresu_2467        CDS       T01461                                 

Definition
(GenBank) preprotein translocase, SecE subunit
  KO
K03073  preprotein translocase subunit SecE
Organism
tsu  Treponema succinifaciens
Pathway
tsu02024  Quorum sensing
tsu03060  Protein export
tsu03070  Bacterial secretion system
Module
tsu_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    Tresu_2467
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Tresu_2467
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Tresu_2467
Secretion system [BR:tsu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   Tresu_2467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecE
Motif
Other DBs
NCBI-ProteinID: AEB15329
UniProt: F2NTZ7
Position
complement(2628495..2628674)
Genome map
AA seq 59 aa AA seqDB search
MKKIFQFFKECAGELRKVTWPTRSDVLSSTKVVFISTIIVALILGFLDWLFTEGLRLVF
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatttttcagttttttaaagaatgtgccggagagcttagaaaagtaacttgg
cctacacgcagcgacgttctttcttctacaaaggttgttttcatctctacaattattgtc
gcattgattcttggctttcttgactggttgtttacagaaggcctacgcctcgtattctag

DBGET integrated database retrieval system