KEGG   Treponema succinifaciens: Tresu_2477Help
Entry
Tresu_2477        CDS       T01461                                 

Definition
(GenBank) filamentation induced by cAMP protein Fic
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2635207..2635959)
Genome map
AA seq 250 aa AA seqDB search
MKNEIIAVLNEYNSLGINQQLDYDKFYLYSIITHSTAIEGSTITEIENQVLFDNGISCSK
PISEQFMNLDLKKAYEQSFDFARKHEKITVGFLCSLSGTLMKNIDSAYNTVAGSFSSAKG
ELRLLNVSAGRGGKSYLAWQKVPDRLQEFCGWLNEELEKTDSDDIENAYKLSFESHFKLA
SIHPWADGNGRMDRLLMNVVKYEKNLVPSVVKKERRAEYIKVISASLIDFMFNHHIQNLK
QQIEEYKRSL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaaataatagcggtcttgaatgaatataattctcttggaataaatcagcag
cttgattacgataagttttatttatattcgataattacacattcaacagcgattgaaggc
tctacgattacggaaattgaaaatcaggttttgtttgacaacggaatttcttgttcaaag
cctatttcagagcagtttatgaatcttgacctgaaaaaagcgtatgaacagagctttgat
tttgcaagaaaacacgaaaaaataacagttgggtttctttgttctctttctggaacttta
atgaaaaatatagattccgcttataatacagttgcaggttctttttcttctgcaaaagga
gaattaaggcttttgaatgtaagtgctgggcgcggcggaaaatcttatcttgcttggcaa
aaagttcctgacaggcttcaagaattctgcggctggctcaatgaagaacttgaaaaaact
gattcagatgacattgaaaacgcatataaattaagttttgaatctcattttaagcttgct
tcaattcatccttgggctgacggaaacggaagaatggaccgtttgctgatgaatgtggtt
aaatatgaaaaaaatcttgttccatcggttgtaaaaaaagaaagacgtgctgaatatata
aaggtaatttccgcaagcctcattgactttatgtttaatcatcatattcaaaatctaaag
cagcaaattgaagaatacaaaagaagtttatga

DBGET integrated database retrieval system