KEGG   Treponema succinifaciens: Tresu_2481Help
Entry
Tresu_2481        CDS       T01461                                 

Definition
(GenBank) Methyltransferase type 11
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Ubie_methyltran TehB MTS MetW N2227 RrnaAD NodS Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AEB15343
UniProt: F2NWM4
Position
2639186..2639962
Genome map
AA seq 258 aa AA seqDB search
MTEIEKHYNKHKEENRLLTRHGKVEFAVAMKYIHDSLPTQDKHLFKIADIGAGTGRYSVA
LAKEGFDVTAVELVKHNLEILESKHEHVKCWPGNALDLSFLPDETFDATILFGPLYHLHK
EEEKLTALKEARRITKKGGKIFAAYLLNEYSILSYCFAQNRILELIKSGNVSKDFHIVPK
ENELYDYVRLEDIDRLNKMGGIKRIKIFSPDGPADFMRKELNSMTEETFKKFIEYQICNA
ERKDLLGAGSHIVDILEN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaatagaaaagcactacaataagcacaaggaagaaaacaggcttttgacgcgg
cacggaaaagtcgaattcgccgtcgcaatgaaatacatccatgattctcttcctacgcaa
gacaaacatctttttaaaattgcggacattggagccggaacaggaagatattcagttgca
cttgcaaaagaaggatttgatgttacagcggttgagcttgtaaagcataatcttgaaata
cttgaatccaaacacgagcacgtaaaatgctggccgggaaacgcgcttgaccttagtttt
ttgccagatgaaacttttgatgcaacaattctttttgggccgctttatcatcttcataag
gaagaagaaaaactcacagctttaaaagaagcgcgcagaataaccaaaaaaggcggaaaa
atttttgccgcgtatcttttaaacgaatacagcattctttcatattgctttgcgcaaaac
agaatccttgagcttataaaaagcggaaatgtctctaaagattttcatattgtgccaaaa
gaaaatgagctttacgactatgtccgcctagaagatattgacaggcttaacaagatgggc
ggaataaagcggataaaaatattttctccagacggacctgcggactttatgcgcaaagaa
ctgaactcaatgacagaagaaacttttaaaaaattcattgaataccagatttgcaatgcg
gaacgcaaggatcttctaggcgcaggctcccacattgtagatattctggaaaactaa

DBGET integrated database retrieval system