KEGG   Treponema succinifaciens: Tresu_2485Help
Entry
Tresu_2485        CDS       T01461                                 

Definition
(GenBank) diguanylate cyclase/phosphodiesterase
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2643943..2646408)
Genome map
AA seq 821 aa AA seqDB search
MAKKRFFSILMGIASFLLLSSVLSLCFFLYRNRLSSTLVNTKLKNPRANVLFLSSMPNSY
VVKLQKKGIRNVFLKNNINVDVEYFEPDDFYDKKLPEFLKERVKFLQQETKYDAVLVSGS
NSCNFVERNSDSLFAGIPIVFFCIESNIRAERLYEKKNFWGIGTTRFLADTISVARKLFP
SAEHYVAIYDKSDASYENYNVFINASEKIPNIKFSGIDASAFTKSQIARQLSALDDKTVV
FYLGASKDADGIKYSMEEQANFIVNNTSAPVFSHNANGVGFGFLGGKMVDYEKAGALAAK
IVLDIIDGEKYIPFQRIKDGKFIFDYKIIEERKLNLSAFPLDSVFVNIHDQMQKNRRGVL
FGMIGVAVSLFIFIAVSLILIISQVKDSYELRRSNLKMEYMLGHDSLTDLPNRFKTQAVF
NDIQKSGKNFSLVLFDIDDFKNINDFYSHACGDIVLKTIASRLKSYSAGKDIFVSRFGGD
EFLVLYLEKQLNEDSIEIHELRAILKSPINYAESNIHIQSSLGIVNSNDDEMEKMIQNAD
IALYRAKNSGKNKSVFFNEKMRDRIFENNRISRILDDAIANDGIWVAYQPQIDVETGEIH
GYEALMRLKNTKVSPAQFIPIAEETGRIIKIDRILTEKVVRQMAEWREHGIPLYKVSINY
SYSQVSDVHYVDFLEELLKRYNIPPELICIEITESLFISNKEAVSKLLNEFVKRGISLAL
DDFGTGYSSLSYLTFLPINVVKIDKSLVDNYLSNEKGDFIKNIVRLVHSLAMKLTVEGVE
HQWQNEKLKTFHCDYIQGYYYSKPISGAEIEDFNRKFRSIG
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaaagatttttttctattctgatgggcattgcgtcttttcttcttttgagc
agtgttctttcgctttgtttctttctatatagaaaccgtttgtcttcaactcttgtaaat
acaaagttaaaaaatccaagagcgaatgttctttttttaagctcaatgccgaactcttat
gttgttaagcttcagaaaaaaggaataagaaatgttttcttaaagaacaatataaatgtc
gatgttgaatattttgagcctgatgatttttatgataaaaagcttccagaattcttaaag
gagcgtgttaagtttttgcagcaggaaacaaaatatgacgctgttcttgtaagcggaagt
aattcatgcaactttgttgagcgcaatagtgattctctttttgcaggaattcctattgtg
tttttttgcatagaaagcaacataagggcggaacgtctttatgaaaaaaagaatttctgg
ggaatcggcacaacaagatttttggcggatacaatttcagttgcaagaaagctttttcct
tctgcagaacattatgttgcaatttatgacaaaagcgatgctagttatgaaaattacaat
gtattcataaatgccagtgaaaaaattccaaatattaagttttctggaattgatgcttct
gcatttacaaaaagccagattgccagacagctttccgcgctggatgacaagactgttgtg
ttttacttgggagcttcaaaagatgctgacggcataaaatattccatggaagaacaggcg
aactttattgtaaataacacttctgcacctgtattcagccacaatgcgaatggcgtggga
ttcggctttcttggcggaaaaatggttgactatgaaaaagccggtgctctcgccgcaaaa
atcgtgcttgatattattgacggtgaaaaatacattccgttccaaagaataaaagatgga
aaatttatttttgactacaagataatcgaagagcgcaagttaaatctttcagcttttcct
cttgattctgtgtttgtaaatattcatgatcaaatgcaaaaaaacaggcgcggagtttta
tttggaatgatcggagtcgcggtttcgctttttatttttattgcggtttctttgattctt
ataatttcgcaagtaaaagattcgtacgagcttcgtcgttcaaacttaaaaatggaatat
atgcttgggcatgattcgcttacagatttgcctaacagattcaagactcaggctgtgttc
aatgatattcagaaatccggaaaaaacttttcgcttgttctttttgacattgacgacttt
aaaaatataaacgacttttattcccatgcttgcggcgatattgttttaaagacaattgct
tcaaggctcaaatcttattctgccggaaaagatatttttgtttcgcggttcggtggagat
gaattccttgtgctttatcttgaaaagcaactgaatgaagattcaatagagattcatgaa
cttagagctattttaaaaagtccgattaactatgctgaaagcaatatccatattcagtct
agcttgggaattgtgaattctaatgatgatgaaatggaaaaaatgattcaaaatgcggac
attgcgctttaccgtgctaagaattccggaaagaataagtcggttttctttaacgaaaaa
atgcgagaccgcatatttgaaaataaccgtatttcaagaattcttgatgacgctattgca
aacgacggaatttgggttgcgtatcagccgcagattgatgttgaaactggagaaatccac
ggatacgaagctcttatgaggctaaaaaacaccaaagtttcgccggcgcagtttattccg
attgcagaagaaacaggtcggattataaaaatcgacagaatccttacagaaaaagttgta
aggcagatggcggaatggcgcgagcacggaattcctttgtacaaagtttcaataaattat
tcctacagccaggtttcggacgttcattatgttgatttccttgaagagcttttaaagcgt
tataatattccgccggaacttatctgcattgaaattacagaaagcctgtttatttcaaac
aaggaagcggtttcaaagcttttgaatgaatttgtaaagcgtggaatttctcttgccttg
gacgactttggaactggatattcttcccttagctatcttacattcctgccgattaatgtt
gtaaaaatcgacaagtcgcttgtggacaattatctttcaaacgaaaaaggcgactttata
aagaacatcgttcgccttgtccattcgcttgcaatgaagcttactgttgaaggtgttgag
catcagtggcagaacgaaaagcttaagactttccattgcgactatattcagggctactat
tattccaagccgatttccggggcagaaatagaggacttcaacagaaagttccgcagcatt
ggataa

DBGET integrated database retrieval system