KEGG   Treponema succinifaciens: Tresu_2491Help
Entry
Tresu_2491        CDS       T01461                                 

Definition
(GenBank) metal dependent phosphohydrolase
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD HD_5 HDOD CBM_2
Motif
Other DBs
NCBI-ProteinID: AEB15353
UniProt: F2NWN4
Position
complement(2653115..2654440)
Genome map
AA seq 441 aa AA seqDB search
MKKFLKKIYIVLLAVSFLAATVGFFVFATTKEHITENDISPDVQFSIGKRQLKGDVWTIY
VPHIASDNPEKGNLTGRIYTGVVKNLNKHAIKSWNVEINITQHCYLNNAWNGFVEIYKSR
AEKKPSQPLIDLKKAKESDFSVKTIKNLNNILIPLNPGSRIVFYPSIEKYIPGRLLDVNS
ISMGFVFYTEDGNELMKFKSWKVNYEFENGLFYRPFFYIFLLFYIMWFCLVISGIRLHAI
RLAKERDREHDRFMLEQVIKAFTKFIDAKDIYTGGHSERVAKYSYMLAKEMGKSRDECLN
AYYCGLFHDCGKIGIPDEIIRKPEKLTDDEYKIMQSHTTTGYNLLKELTLIPDACLAALY
HHERIDGTGYPKGLKGEEIPEIVRIISVADVFDCMSQDRCYRKAFSLEKIIEDFKMNSGK
QFDPEVVKAFLSLAEKGAFKV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttcttaaaaaagatttacatagttcttctcgcagtttcgtttttggctgca
acagttggattttttgtttttgccacaacaaaagaacatattaccgaaaatgatatttct
ccagatgttcagttttcaataggaaaacgacagctaaagggagatgtctggacaatttat
gttcctcatattgcttctgataatccagaaaaaggaaaccttacaggcagaatctacacc
ggagttgttaaaaatcttaacaagcacgcgataaaaagttggaatgtggaaataaacatt
acgcagcattgctatttgaataatgcttggaacggatttgttgaaatttataaaagccgg
gcggaaaaaaaaccgtctcagcctttaatagacttaaaaaaagcaaaggagtctgacttt
tcagttaagacaataaaaaatctgaacaacattcttattccgcttaatcctggcagcagg
attgttttttatcccagcatagaaaaatatattccgggtagacttctggacgtgaacagc
atttccatgggctttgttttctatactgaagatggaaatgagcttatgaaattcaaatct
tggaaagtaaactacgaatttgaaaacggattattttatcgtccatttttctatattttt
ttgcttttctacataatgtggttttgtctcgtaatttctggaatcagacttcatgctata
aggcttgcaaaagaaagagaccgtgagcatgacagatttatgcttgagcaggtaataaag
gcatttacaaaatttatcgatgccaaggatatttacacaggcggacattcagagcgcgtt
gcaaaatactcatatatgcttgcaaaggaaatgggcaagtctagagatgaatgccttaac
gcctattactgcgggcttttccatgattgcggaaaaattggtattcctgacgaaattata
agaaagccagaaaaacttactgatgacgaatacaagattatgcagagccacacaacaact
ggctataatcttctaaaggaacttacattgattcctgatgcttgccttgccgctctttat
caccatgagcggattgacggcacaggctacccgaaaggtcttaaaggagaagaaatcccg
gaaattgtgcgcattatttctgttgctgacgtttttgactgcatgagtcaagaccgttgc
tatagaaaggctttttcgctggaaaaaatcatagaggactttaaaatgaacagcggcaag
caatttgaccctgaagttgtaaaagcgttcctaagccttgcagagaaaggtgcgttcaag
gtctga

DBGET integrated database retrieval system