KEGG   Treponema succinifaciens: Tresu_2493Help
Entry
Tresu_2493        CDS       T01461                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tsu  Treponema succinifaciens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tsu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2656861..2658345)
Genome map
AA seq 494 aa AA seqDB search
MLNKRACGVLMHISSLPGKTGIGTMGKNAYEFVDYLKSADQKYWQILPVCPTSYGDSPYQ
SFSTFAGNPYFIDFDFLMEQGFLQKSDYENVNWGGNERYVDYGTLYIERHKVFSIIQKNF
NKNIPSDFDSFCAENAFWLEDYSLFMAIKDAHGGIAFDFWEEDIRCRKPDALDAWKKKSA
ECMQYYKMLQYFFFKQWYALKKYANEKGIQIIGDIPIYVAADSSDVWSNPSQFMLDENYK
PIEVAGCPPDGFSADGQLWGNPVYNWEYMKQTDYAWWKKRLEKSMAIYDVIRIDHFRGFD
SFYCIPYGSTNAKVGVWRQGPGMDLFNSLKKQFGEMPVIAEDLGFLTDSVKQLLKDSGFP
GMKVLQFAFDSRETSDYIPYRYTQNCVVYTGTHDNDTILGWTETAAKKDVENAKEYLRVK
ENRDVVKEMMIAAISSVANTCILTMQDLIGLGKEARMNIPSTVGNNWKWRATKEQFSEDS
RNFLAHFTHLYGRA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacaaacgtgcttgcggtgtgctgatgcacatttcgtctttgcctggaaaaaca
ggaattggaacaatgggtaaaaacgcctatgagtttgttgattatctgaaaagcgcagac
caaaagtactggcagattcttccggtttgtcctacaagctatggagattcaccttaccaa
agtttttctacttttgctggaaatccttactttattgattttgattttttgatggaacag
ggatttttgcagaaatccgactacgaaaatgtgaactggggcggcaatgagcgctatgta
gattacggaacattgtacattgagcggcataaagttttttcaataatccagaagaatttc
aataaaaatattccatctgattttgattctttctgcgctgaaaatgcgttttggcttgaa
gactattctctttttatggctataaaagatgctcacggaggaattgcatttgacttttgg
gaagaagacatccgctgcagaaagccagatgcccttgatgcttggaaaaagaaatccgcg
gagtgtatgcagtactacaaaatgctccagtattttttctttaagcagtggtatgccctt
aaaaaatatgcgaatgaaaaaggaattcagattataggcgacattccgatttatgttgcg
gcggacagttccgatgtttggtcaaatccaagccagtttatgcttgacgaaaattacaag
ccaattgaagttgccggctgtcctccagatggattttctgcggacggtcagctctgggga
aatcctgtatacaactgggaatatatgaagcagacggattacgcctggtggaaaaaacgc
cttgaaaaaagcatggcgatttacgatgttatcagaattgaccatttccgcggatttgat
tctttctattgcattccttatggctctacaaatgcgaaagttggtgtttggcggcaggga
ccgggaatggatttgtttaattcgcttaaaaagcagtttggcgaaatgcctgttattgcg
gaagaccttggattccttacagacagcgtaaagcagcttttaaaggattcaggattccct
ggaatgaaagtgcttcagtttgcatttgattcccgcgagacaagcgactacattccttac
cgctacacacagaattgcgttgtttacacaggaactcacgacaacgacacaattcttggc
tggacagaaactgccgcgaaaaaagacgtggaaaatgcaaaggaatatcttcgtgtaaaa
gaaaaccgcgatgttgtaaaggaaatgatgattgccgcaatttcgagtgttgcaaatact
tgcattcttactatgcaggatttgattggacttggtaaagaagcccgtatgaatattccg
tcaacagttggaaacaactggaaatggcgcgcaacaaaagagcagttttcagaagattcc
agaaatttccttgcgcactttacacatctctacggaagagcttag

DBGET integrated database retrieval system