KEGG   Treponema succinifaciens: Tresu_2495Help
Entry
Tresu_2495        CDS       T01461                                 

Definition
(GenBank) ABC-type transporter, integral membrane subunit
  KO
K10119  raffinose/stachyose/melibiose transport system permease protein
Organism
tsu  Treponema succinifaciens
Pathway
tsu02010  ABC transporters
Module
tsu_M00196  Raffinose/stachyose/melibiose transport system
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Tresu_2495
Transporters [BR:tsu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter [MD:M00196] [OT]
    Tresu_2495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Cytomega_TRL10
Motif
Other DBs
NCBI-ProteinID: AEB15357
UniProt: F2NWN8
Position
complement(2659500..2660345)
Genome map
AA seq 281 aa AA seqDB search
MTLSKQKTCSNTIAFAFLCLLAAIFLIPILLVLLNSFKSRFYISSSPFAMPNSETFVGFE
NYLNGLSSSVFFISFIRSVWVSIASVLVIIVCTSMASWFIVRVKNKFTKAIYFLFAFSMI
VPFQMVMYTMTFIVNRISFDNVFGIVFVYLGFGAGLSVFMFTGFVKAVPLEIEEAAEIDG
CNPLQTFFLVVFPILKPTIITVSILNSMWVWNDYLLPYLILGTDHKTVPVAIQIAMQGAY
GATDYGGFMAMLVLAIIPIVIFYIASQKYIIKGVISGAVKG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacactttcaaagcagaagacctgcagcaacacaatagcttttgcttttctttgcttg
cttgcggctatatttttaattcctattttgcttgttttgctcaattcttttaagtcgcgc
ttttatatttcaagttcgccgtttgcaatgccgaactcagagactttcgttggttttgaa
aactacctgaacggactttcgtcttcggtattctttatttcgtttatccgttctgtgtgg
gtttcaattgcttcggttcttgttattatagtatgcacatcgatggcttcctggttcatt
gtccgtgtaaaaaataaattcacaaaggcaatttattttctgtttgcattcagtatgatt
gttccgttccagatggttatgtacacaatgactttcattgtaaacagaatcagttttgac
aacgtttttggaattgtctttgtttaccttggattcggagccggactttctgtatttatg
tttacaggatttgtaaaggctgttccgcttgaaattgaggaagctgctgaaattgacggc
tgcaatccgcttcagactttcttccttgttgttttcccgattctaaagcctactattatt
acggtttcaatcttgaactctatgtgggtttggaacgactatttgcttccttatcttatt
ttaggaacagaccacaaaactgttcctgttgcgattcagattgcaatgcagggagcttac
ggcgcaactgattacggcggattcatggcgatgcttgttcttgcgattattccgattgta
attttctacattgcttcgcaaaaatacattataaaaggcgtaatttccggggcggtaaaa
ggctag

DBGET integrated database retrieval system