KEGG   Treponema succinifaciens: Tresu_2507Help
Entry
Tresu_2507        CDS       T01461                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
tsu  Treponema succinifaciens
Brite
Enzymes [BR:tsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     Tresu_2507
Ribosome biogenesis [BR:tsu03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Tresu_2507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 Glyco_transf_8
Motif
Other DBs
NCBI-ProteinID: AEB15369
UniProt: F2NWQ0
Position
complement(2672606..2673523)
Genome map
AA seq 305 aa AA seqDB search
MKETLHFVKASTRYKREHKSDYGKERIEILYEDKDIVVINKASGLLSVPYPGSKSRTAIE
LLEKIMRKKGTFSESRRPFVVHRLDRDTSGVMMFALNERVQKKIMSSWKTMVTDRLYRAV
AENPRRNHPELTDSGLIDEPLAKNACHQGYVPKKLGDNAETCEARTNFRVVLRGRTHTLF
ELSLDTGKKNQIRAHLASRHYPLAGDENYRARTDPFHRLALHARTLAFIHPVTGEKMSFE
IPEPEEWELYVKKGDLHPQTPVWANERKERIQYNAQIENIKTPDHSLRRQARKMDFIARG
KSGIK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaactttgcattttgtaaaagccagcacaaggtataagagagagcataaaagc
gactatggaaaggaacgcatagaaattctatatgaggacaaggatattgttgttataaac
aaagcttcagggcttctttctgttccttatccgggaagcaagtcccgtactgcgattgag
cttctggaaaaaatcatgcgtaaaaaaggaactttttctgaaagccgccggccttttgtt
gtacatcgtttggacagagatacaagcggagttatgatgtttgccttgaatgaaagggta
cagaaaaaaataatgtctagctggaaaactatggttacagataggctttatcgggctgtt
gctgaaaatccccgaagaaatcatcctgaactgacggattctggtctcattgatgagccg
cttgcaaaaaatgcgtgccaccaaggatatgttcccaaaaaacttggtgataatgctgaa
acttgcgaggcacgcacaaatttccgtgttgtgctgcgtggcagaactcatactcttttt
gagctttctttggatactggaaagaagaatcagataagggcgcatttggcttcaaggcat
tatccgcttgccggagacgaaaattatagggccagaactgacccctttcataggcttgcg
cttcatgcaagaacgctggcatttattcatcctgttacaggagaaaaaatgagctttgaa
attccagagccagaagaatgggagttgtatgttaaaaaaggcgatttgcatcctcaaact
ccagtttgggctaacgaacgtaaggagcggattcagtataatgcgcagattgaaaacata
aaaactcccgaccattcgttacgccgacaggctagaaaaatggactttattgcgcgtgga
aaatcaggaataaaataa

DBGET integrated database retrieval system