KEGG   Treponema succinifaciens: Tresu_2514Help
Entry
Tresu_2514        CDS       T01461                                 

Definition
(GenBank) hypothetical protein
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEB15376
UniProt: F2NWQ7
Position
complement(2681598..2681966)
Genome map
AA seq 122 aa AA seqDB search
MNKKVFYLLYILISSIVNILFTALIIGSLFGICLVFLKFVFHAASFEAYGNALFGSFTIG
LVLSFFLYSKITTKFVKKYSLDEKFGGSPKKTKDSSENTVAARKTVLPDSVKEEEEDEKW
RK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaagttttttatcttctatatatattgatttcaagcattgtaaacattctt
tttactgcgctgataattggctcgctttttggaatttgccttgtcttcttgaaatttgtt
tttcatgcggctagttttgaagcatacggaaacgcgctgtttggaagctttacaatcgga
cttgtattaagcttttttttgtattcaaaaatcacgacaaaatttgtaaaaaaatattca
cttgatgaaaaattcggcggttcaccaaaaaaaacaaaagattcttctgaaaatacagtt
gccgcaagaaaaacagttcttccagattctgtaaaagaagaggaagaagatgaaaaatgg
cgtaaatag

DBGET integrated database retrieval system