KEGG   Treponema succinifaciens: Tresu_2520Help
Entry
Tresu_2520        CDS       T01461                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K19954  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
tsu  Treponema succinifaciens
Brite
Enzymes [BR:tsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Tresu_2520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2686149..2687303)
Genome map
AA seq 384 aa AA seqDB search
MADFIFKISPNIVLGSYTATRLGQYALEYGSNFLVLMDPVLKESGTASKVTASLAERNVD
YFVFDEIPLGSDSETAKVVLKLAQDAKVHGVIAVGGGRTLSLARIVCALYYENSKSIYDY
IDENLIPPKRTLPLICLPSTNRDSFIFTDRAFVTDARSTKVKLIKTQNGLCKLVLWDPNL
QMALTEKQISCMSIEALAFAVEGYLSQKSTFFSDMIIEKSVQLLSYAEDGAPNLSVTTPQ
EVLLAQGGCMASLGAASSSFGAANLLSLAINSRYKISRSLISAILLPYIIEDAASFKAEK
LAVLSRLLNASRPEDSVSSAVASLADYVRQKIAKINIPARLKDLSLSIEQLSVAAEDAGE
LDLMNSLQRSMTTDDLFEIIKKAY
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcagattttatattcaaaatttcacctaatattgttcttggttcttatactgcgacc
cgtcttggtcagtatgcgttggagtacggctctaattttttggttttaatggatccggtt
ctaaaggaatcgggaacagcttcaaaagttacggcgtctcttgcagaaagaaacgttgat
tattttgtttttgacgaaattccgcttggatctgattcagaaactgcaaaagttgtcttg
aagctcgctcaggatgcaaaagtacatggagttattgcggttggaggcggaagaacactt
tcgcttgcacgcattgtctgcgctctttactacgaaaattccaagagcatttacgattat
attgacgaaaatttgattccgcctaaaagaactcttccgcttatttgcctgccttcaaca
aatagagatagttttatttttacagacagagcttttgtaactgacgcgcgttcaacaaaa
gtaaagcttataaaaactcaaaacggactttgcaagcttgttctttgggatccgaatctt
cagatggctttgacagaaaagcaaatttcctgcatgtcaattgaagctttggcttttgcg
gttgaaggatatttaagccagaaatctacttttttcagcgatatgattatagaaaaatcc
gttcagcttttgagttatgccgaagatggcgcaccgaatctttccgttacaactccgcag
gaagttcttttggcccagggcggatgcatggcttctttgggggctgcctcaagttctttt
ggcgccgcaaatcttctttcgcttgcaataaattctcgatataaaatttcccgctcgctg
atttctgcaattttacttccgtatattattgaagatgcggcttctttcaaggctgaaaaa
cttgcggttctttcacgtcttttgaatgcctcccgcccggaagattctgtttcttcggct
gttgcttctcttgcggattatgtaagacagaaaattgctaagataaatattccggcacgt
ttaaaagacctttcgctttctatagaacagctttctgttgcggcggaagatgcaggtgag
cttgatcttatgaacagtcttcagcgcagcatgacaactgacgatttgtttgaaatcata
aagaaggcttactga

DBGET integrated database retrieval system