KEGG   Treponema succinifaciens: Tresu_2527Help
Entry
Tresu_2527        CDS       T01461                                 

Definition
(GenBank) Tetratricopeptide TPR_2 repeat-containing protein
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_19 ANAPC3 TPR_16 TPR_6 TPR_1 TPR_8 TPR_12 TPR_17 TPR_11 TPR_20 Mrr_cat TPR_14 IL31 SRP_TPR_like PAP_RNA-bind TPR_21 Fis1_TPR_C
Motif
Other DBs
NCBI-ProteinID: AEB15389
UniProt: F2NWS0
Position
complement(2695278..2696618)
Genome map
AA seq 446 aa AA seqDB search
MSYLIAGVIMIALVAVLTLFMGKNGGGSTKDKKTSNRNKAQIIKEANKKLAKNPHDPAGL
IPLGDVYFSSQIWDKAYLIYNDLSKLDSKSGFVNLGECFLRLGISALQLGKNPEAVQALV
SAYKINSVSFENNFYLGKAMFNQKLYEKSVPLFKKAILAKPESTGVYFLLAQSLYFAKKY
RECLSFFKKALDEDPSNKEALFNMSDAMFQEGRGDRAIKIFMHLRADPVYGARSCLRAGI
FHTKINDLNSAIQDYEIGLKHENEPSDIRVEIEYNLARCYFEKNQIAKGLALLKAIRNSV
QNYKDVNSLINRYQELSQNNNLQIYISANSNDFVTLCRKFILTKYKNSNVKIQNIENDSL
YTDILTEIFAATWQDVVLFRFFRTTGSVGEIYIREFHEHMSDVNAERGFCVSAGIFSEES
KKYIEGRPIDLIEKTELTKILKQISI
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatcttattgctggcgttataatgattgctcttgtcgccgttcttactttgttc
atgggaaaaaatggcggcggcagcaccaaagataaaaaaactagcaatagaaacaaagcc
cagattataaaagaagcaaacaaaaaacttgcgaaaaatccgcatgatccggcgggtctt
attccgcttggcgatgtttatttttcgagccagatttgggacaaggcatatttgatttac
aatgacctttcaaagcttgattcaaagtctggttttgttaatttaggcgaatgttttttg
cggcttggaatcagcgcgcttcaacttggaaaaaatccagaagcagttcaggctttggtg
agcgcatacaaaataaattcagtcagctttgaaaataatttttaccttggcaaggcaatg
ttcaaccaaaagctttatgaaaaatccgtgcctttgtttaaaaaagcgattcttgccaaa
cctgaatctaccggcgtttattttttgcttgcacaaagtctttattttgccaagaaatac
cgagaatgtctttctttctttaaaaaagctttagatgaggatccttcaaataaagaagcg
cttttcaatatgtcggatgcgatgtttcaggaaggacgcggcgaccgtgctataaaaatt
tttatgcatcttagagctgatcctgtttacggcgcaaggtcttgtcttagagccggaatt
tttcatacaaaaataaatgacttgaattccgcaattcaggattatgaaatcggacttaag
catgaaaacgagccttctgatataagggttgaaattgaatacaaccttgcccgctgttat
tttgaaaagaatcagattgcaaaaggtcttgcgcttttaaaggcaatccgaaattctgtt
cagaattacaaggatgtaaattcgcttataaaccgttaccaggagctaagccagaacaac
aacctgcagatttatatttccgcaaatagcaacgattttgtaacgctttgccgtaaattt
attttgactaaatataaaaattcaaacgtaaaaattcaaaatatagaaaacgactcgctt
tatactgatattctaactgaaatttttgcggcaacttggcaagatgttgtattgttcaga
tttttcaggacaacaggttctgtcggcgaaatttacatcagggaattccatgagcacatg
agcgatgtaaatgctgagcgcggattttgtgtttccgcaggaattttttcagaggaaagc
aaaaaatatattgaaggccgcccaatcgatttaatagaaaaaacagaacttacaaaaata
ttaaagcagatttcaatttaa

DBGET integrated database retrieval system