KEGG   Treponema succinifaciens: Tresu_2529Help
Entry
Tresu_2529        CDS       T01461                                 

Definition
(GenBank) transcriptional regulator, AsnC family
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsnC_trans_reg HTH_24 HTH_AsnC-type RPA_C HTH_15 DUF2250 HemN_C HTH_Crp_2 TFIIE_alpha FeoC GYD HTH_19 HTH_DeoR DUF742 DUF1378
Motif
Other DBs
NCBI-ProteinID: AEB15391
UniProt: F2NWS2
Position
complement(2697906..2698400)
Genome map
AA seq 164 aa AA seqDB search
MDSTEEILNLLRDNARISVEDISAMTKKSVEEVKSIIQQLENDGVIMKYAAIINPEKDSK
AKEKVCAEIEIQVTPEREHGFDGIADRIYRFPQVKSLYLMSGGYDLKVIIEGETLQEVAL
FVARKLSTLQGVRSTKTHFILKTYKENDIVYIEENSDSREGAMA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggacagcacagaagaaattttaaatttgctgcgtgacaatgcgcgtatttctgtagaa
gatatttccgcgatgacaaagaaatcagttgaagaagtcaagtcgattatccagcagctt
gaaaatgacggcgttattatgaagtatgccgcaattataaatcctgaaaaagattccaag
gcaaaagaaaaagtctgtgcggaaatagaaattcaagttacgccagaacgcgagcatgga
tttgacggaatcgccgacagaatttacaggtttccgcaagtaaaatccctttatcttatg
agcggcggctatgatttaaaagtaataattgaaggtgaaactttgcaggaagtggcgctt
tttgttgcaagaaaactttctacgcttcaaggtgtgcgctccacaaaaacccattttatt
ttaaagacttacaaagaaaatgacattgtttatatagaagaaaattccgacagccgggaa
ggagcaatggcttaa

DBGET integrated database retrieval system