KEGG   Treponema succinifaciens: Tresu_2530Help
Entry
Tresu_2530        CDS       T01461                                 

Definition
(GenBank) Imidazoleglycerol-phosphate dehydratase
  KO
K01693  imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00340  Histidine metabolism
tsu01100  Metabolic pathways
tsu01110  Biosynthesis of secondary metabolites
tsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Tresu_2530
Enzymes [BR:tsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     Tresu_2530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD
Motif
Other DBs
NCBI-ProteinID: AEB15392
UniProt: F2NWS3
Position
complement(2698428..2699045)
Genome map
AA seq 205 aa AA seqDB search
MERTASIKRITGETQIELSLNLDGTGKCSVKNPIGFFGHMLNSFCKHGLFDLSGELKGDL
EVDQHHLVEDAGIVLGQCFASALGNCAGIYRSGFSIYPMDESLLQAAVDFGGRPFCVVNA
ALSNIPLVSIGQDGKSSSFQTDCFDDFWQGFVNGAKCNLHLDTIRGRSDHHKIEGLFKAA
ARAIRQAVEIDPRRNGEIPSTKGLI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaactgcaagcataaaacgcataactggtgaaacacaaatagagctttcttta
aatcttgacggaactggaaaatgctctgtaaaaaatccaataggcttttttggccacatg
ctgaattctttttgcaagcatggactttttgatttgagcggagaattaaaaggcgatttg
gaagttgaccagcatcatcttgtagaagacgcaggaattgttcttggacaatgctttgct
tctgctttgggaaactgcgctggaatttatagaagtggattttcaatttatccgatggat
gaaagtcttttgcaggctgctgttgattttggcggacgtccgttttgtgttgtaaatgcg
gctctttccaatattccgcttgtttcaattggacaggacggaaaatcttcttcgtttcaa
actgattgctttgatgatttttggcagggatttgtaaacggcgcaaaatgcaatttgcat
cttgatacaatccgcggaagaagcgatcatcataaaatcgaaggactttttaaagccgca
gccagggcaattcgtcaggcagtagaaattgatccaagacgcaacggagaaattccaagc
acaaaaggactgatttag

DBGET integrated database retrieval system