KEGG   Treponema succinifaciens: Tresu_2547Help
Entry
Tresu_2547        CDS       T01461                                 

Definition
(GenBank) regulatory protein TetR
Organism
tsu  Treponema succinifaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N HTH_Tnp_1_2 HTH_23 Sigma70_r4_2 HTH_AsnC-type HTH_24 MerR EST1_DNA_bind
Motif
Other DBs
NCBI-ProteinID: AEB15409
UniProt: F2NXR5
Position
complement(2714781..2715374)
Genome map
AA seq 197 aa AA seqDB search
MRNANPELVSSIKKRTLELLMEKELEEIGMREIAKKCGVSATAIYHYYRDKDCLFQAISL
DCLNQINSVIEAAAEKAASSKEKVLAAIRAFRNWSLKNPRVASLVMEKIKSAVNLPPEET
EKFYVCNRTGEKLLELCIAEGAARSENPRLDVGVLVFGLWGCLQSVISRKSEVEYWENSE
PFTERFISMWAENIFVN
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatgcgaatcctgagctggtttcttccataaaaaagcggacacttgagctttta
atggaaaaagaacttgaggaaatcggaatgagggaaattgccaaaaagtgcggcgtttca
gccacggcaatttatcattattatagggacaaggactgcctttttcaggcgatttcgctg
gactgtctgaaccagataaattcggtgattgaagccgccgcggaaaaagccgcttcttca
aaggaaaaggttcttgccgcaatcagggcgtttcgcaactggagccttaaaaatccgcgg
gtcgcctctcttgtgatggaaaaaataaaatccgcggtgaatcttccgccggaagaaact
gaaaaattctatgtctgcaaccgcaccggggaaaaacttcttgagctttgtattgcagaa
ggagcggcgcgttctgaaaatccccggctggatgtcggtgtgcttgtattcggactttgg
ggctgtcttcagtccgtgatttcgcgcaagtcggaagttgaatactgggaaaattccgag
ccgtttacagaacgttttatcagtatgtgggcggaaaatatttttgtaaattaa

DBGET integrated database retrieval system