KEGG   Pseudothermotoga thermarum: Theth_0056Help
Entry
Theth_0056        CDS       T01554                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tta  Pseudothermotoga thermarum
Pathway
tta00230  Purine metabolism
tta01100  Metabolic pathways
Module
tta_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Theth_0056
Enzymes [BR:tta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Theth_0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 ATPase_2 AAA_18 MMR_HSR1 AAA_16 RsgA_GTPase AAA_23 AAA AAA_29 ABC_tran
Motif
Other DBs
NCBI-ProteinID: AEH50163
UniProt: F7YU67
Position
56355..56993
Genome map
AA seq 212 aa AA seqDB search
MKGILYVISGPSGVGKTSIIEGTLKRVRNLVFSVSYTTRKKRPNEIEGKDYFFVDESTFK
SMIERDEFLEWAVVHGNYYGTPKKFVEENLQKGFNVLLDIDVQGAMTVMKKVKDAVYIFI
APPSFDELKQRLIKRGTENEIDLQRRLEDAKKELSYIPKFQYIIVNVNLNESIDQLCSII
VAEQLKVERFIERLGEYRIFEEGGKADARCGA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggcatcctttacgtgatcagtggaccatcaggggttggaaagactagcataata
gaaggtacacttaaacgagtccgcaacttggttttctctgtgtcttacacgacgaggaaa
aaaagaccgaacgaaatagagggaaaggattacttctttgtggatgaatccacttttaaa
agtatgatcgaacgcgacgagtttttggagtgggcagttgtgcatggaaactactatggt
acaccgaaaaaattcgttgaagaaaatttgcagaaaggttttaacgttctgcttgacata
gacgttcaaggtgctatgaccgtcatgaaaaaagtgaaggatgccgtttacatcttcata
gcgcctccatcttttgatgaacttaagcagagattgataaagcgtggaacagaaaatgaa
attgatttacaaagacgtttggaagatgccaaaaaagagttatcttacattccaaaattt
cagtacataatagtcaatgtgaatttgaacgaatcaattgaccagctttgttctatcatt
gttgcagagcagctgaaagttgaaagatttatagaaagattgggagagtacagaatattc
gaagaaggaggtaaagccgatgcgcgatgcggtgcttaa

DBGET integrated database retrieval system