KEGG   Thermotoga thermarum: Theth_0056Help
Entry
Theth_0056        CDS       T01554                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tta  Thermotoga thermarum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Theth_0056
Enzymes [BR:tta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Theth_0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
56355..56993
Genome map
AA seq 212 aa AA seqDB search
MKGILYVISGPSGVGKTSIIEGTLKRVRNLVFSVSYTTRKKRPNEIEGKDYFFVDESTFK
SMIERDEFLEWAVVHGNYYGTPKKFVEENLQKGFNVLLDIDVQGAMTVMKKVKDAVYIFI
APPSFDELKQRLIKRGTENEIDLQRRLEDAKKELSYIPKFQYIIVNVNLNESIDQLCSII
VAEQLKVERFIERLGEYRIFEEGGKADARCGA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggcatcctttacgtgatcagtggaccatcaggggttggaaagactagcataata
gaaggtacacttaaacgagtccgcaacttggttttctctgtgtcttacacgacgaggaaa
aaaagaccgaacgaaatagagggaaaggattacttctttgtggatgaatccacttttaaa
agtatgatcgaacgcgacgagtttttggagtgggcagttgtgcatggaaactactatggt
acaccgaaaaaattcgttgaagaaaatttgcagaaaggttttaacgttctgcttgacata
gacgttcaaggtgctatgaccgtcatgaaaaaagtgaaggatgccgtttacatcttcata
gcgcctccatcttttgatgaacttaagcagagattgataaagcgtggaacagaaaatgaa
attgatttacaaagacgtttggaagatgccaaaaaagagttatcttacattccaaaattt
cagtacataatagtcaatgtgaatttgaacgaatcaattgaccagctttgttctatcatt
gttgcagagcagctgaaagttgaaagatttatagaaagattgggagagtacagaatattc
gaagaaggaggtaaagccgatgcgcgatgcggtgcttaa

DBGET integrated database retrieval system