KEGG   Thermotoga thermarum: Theth_0079Help
Entry
Theth_0079        CDS       T01554                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tta  Thermotoga thermarum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tta00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
75274..76275
Genome map
AA seq 333 aa AA seqDB search
MDTKMLLMELTKVDGPSGYEDEVISLIEEKIKPFVDEVWRNKVGTLVAFKKGEGKEKLGI
FAHVDEVGFVITKVEPDGFARLETIGGVDPKVLFAQRIKIFTSKGIATGVVGVLPPHLQK
EEHRKSVPSYDKIFVDLSCSPLATHVKVGNVCVVESEPVELNGKLSAKALDDRAGCAALI
LAAEMLQRIKNKSDVYFIFSSQEEVAGPGAVSIAYELELQKAIVVDVTHANEKVPQFPTI
KLSEGPALCVGPTVDREFFSAIRELAEKNGVRIQIEPSPGRSGTDTDEIQLTKTGVKTML
VSIPLMYMHTPVEVVDPKDVEETARLLALATTI
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
ttggatacaaagatgttgttgatggaactgacaaaagtcgatggaccttcaggttatgaa
gatgaagtgatttcgctcatcgaagaaaagataaaaccttttgttgacgaagtttggaga
aacaaagttggtacattggttgcctttaaaaaaggagaaggaaaggaaaaacttggaata
tttgcgcatgtggatgaagtgggttttgtgataacgaaggtcgagcctgatgggtttgca
aggcttgaaacgattggtggtgttgatccaaaggttctttttgcccaaaggataaagatt
tttacttcaaaaggaatagcaacgggtgttgtgggcgttttgcctccacatttgcaaaaa
gaggagcacagaaaatccgttccaagctacgacaaaatttttgttgatctttcctgcagc
cctttggcgactcatgtaaaagtagggaatgtttgcgttgtggaaagtgaaccagttgaa
ctaaacggtaaactgtccgcgaaggctttggacgatcgtgcgggctgcgccgccttgata
ctggctgccgaaatgcttcaaaggattaaaaacaaatcggatgtttatttcatattctcc
agtcaagaagaagttgcaggacctggggcggtttcaattgcttacgagctagaacttcaa
aaggccatagtggttgacgtcactcatgccaacgaaaaggtaccacagttcccaactata
aagctttcagaaggaccagccctctgcgttggccctacggtggatagagaatttttcagc
gccattcgcgagcttgctgaaaagaacggtgtgcgaattcaaatagaaccatcgccaggt
agatccggaactgatacagatgaaatacagctgacaaaaacaggtgttaaaaccatgctt
gtttcaataccgttgatgtacatgcacacaccagtggaagttgttgacccaaaagatgtg
gaagaaacagcgagacttttggcacttgcaacgacaatttaa

DBGET integrated database retrieval system