KEGG   Pseudothermotoga thermarum: Theth_0080Help
Entry
Theth_0080        CDS       T01554                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tta  Pseudothermotoga thermarum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
76295..77308
Genome map
AA seq 337 aa AA seqDB search
MKELSELDGVSGNEKAVRDYIASQIKDKVDEFKIDVLGNLIALKKGTKSRRKILLAAHMD
EVGFMVTNIEEDGTLSFAPVGGVEPQVVIGKKVRIEGKINGVIGYKAIHLQKKEQLLNPP
TYEQLRIYIGAKSKDEASKLVKIGDYVAFATKYLQENDRATGKAFDDRVGCSVLMDIIDK
KERYEDDVYFAFLVQEETGLRGSAVVVEQIFPDIAIVIEGTTAGDDPELPSYQWATHLGD
GPAITFMHRGYVVSRKIYEAILSVARKYGIKHQEKRRTAGGTDARRFATTAYGVPSGVIS
VPARYIHSPICMIDLKDYENTVLLVQKILQEGEEFAK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaattgtcggaactcgatggtgtttccggtaacgaaaaggctgtaagagattac
atagcaagtcaaatcaaagacaaagtcgatgagtttaaaatcgatgttcttggaaatttg
atagctttaaagaagggtacgaaatcaagaagaaaaattctacttgcggcgcatatggat
gaagttggattcatggtcacaaacattgaagaagatggaactttgtcttttgcacccgtt
ggaggagttgaaccacaggttgtgataggcaaaaaggttcgaatagagggaaaaatcaat
ggggtgataggctacaaagcgatacatttacagaaaaaagaacaattgctcaatccacca
acttatgaacagctcagaatttacattggtgcaaagtcaaaagatgaagcatccaaactg
gtgaaaatcggtgattatgtggctttcgcaacaaaatatcttcaggagaacgacagagcc
acaggaaaggctttcgacgacagggttggttgctccgttctcatggatataatcgataaa
aaagaaaggtatgaagacgacgtttactttgcctttttggttcaagaggaaactgggctt
cgtggtagcgcagttgtggtggaacagatctttccagatatcgcaatagtgattgaaggt
acaactgcaggtgatgatccagaacttccaagttatcaatgggcaacgcacttgggagat
ggacctgccataactttcatgcacagaggttatgtggtgagcagaaaaatctacgaagcc
attctgtcagttgcaagaaagtacggtataaaacatcaagaaaaacgaaggactgctggt
ggaactgatgccagaaggtttgccacaactgcctatggtgttccttcgggtgtaatttca
gtacctgccagatacattcacagcccgatttgcatgatagatttaaaggattatgaaaat
acagttttattggttcaaaaaatacttcaggaaggggaggaattcgcaaaatga

DBGET integrated database retrieval system