KEGG   Pseudothermotoga thermarum: Theth_0081Help
Entry
Theth_0081        CDS       T01554                                 

Definition
(GenBank) peptidase M42 family protein (EC:3.2.1.4)
Organism
tta  Pseudothermotoga thermarum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
77305..78309
Genome map
AA seq 334 aa AA seqDB search
MIDLVKKLTEAYGPSGREEEVLNLILSELDGYIDGYKFDNLGNLLVWKTGSSGKKVLLDA
HADEIGLVVTNIDEKGFLRVETVGGVPPHPYVGQRIRFPNAVGIVYVEGETVEERKKNFS
NLNFDNMFVDIGAKSYEEAKSKVPIGSFGVYDSYFFQNGNLLVSKAMDDRIGCAVIVEVF
RRLKKVQNTVIGSFSVQEEVGLVGASVAAYSLNPDVCIAVDVTDSADYPKATKRHSMALG
KGPAIKIKDRASISNRKIVEKLIETAEASKIPYQMEVLIFGGTNAAALQRTRAGIPAATV
SIPTRYVHTPSETVCLDDVEHTVELLIEYSQKGV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatagatcttgtgaaaaaacttacagaagcttatgggccaagtggaagggaagaagaa
gttttaaatctcatattgagtgaacttgacggttacatcgacggttacaagttcgataac
cttggtaacttgcttgtctggaaaacaggttcaagcggtaaaaaagttttgttggatgcg
catgccgatgaaattggactagttgttacaaacatcgacgaaaaaggttttttacgcgtt
gaaacggttggaggtgttccaccacatccgtatgttggacagaggataagatttccaaac
gcagttggaatagtctacgtggaaggtgaaactgtagaggaacgcaagaagaatttttcg
aatttaaactttgacaatatgtttgttgacatcggtgcaaaaagctatgaggaagcgaag
tcaaaagtaccaattggttcttttggagtttacgattcttatttcttccagaatggaaac
cttcttgtttcaaaagccatggatgatagaattggttgtgcagtgatagtagaagtcttt
agaaggcttaagaaggtgcaaaacactgttatagggtctttcagcgtacaagaagaggtt
ggtcttgttggagcatctgtagcggcttattctcttaatccagatgtctgtatagccgtg
gacgtcacagattctgccgattatccgaaagcaaccaagagacattctatggctttgggc
aaggggccagcgataaagatcaaagatcgtgcttccataagcaacaggaaaatagtcgaa
aaattgatcgaaaccgcggaggcttcgaagataccttaccaaatggaagtgttaatcttt
ggtggaacaaatgcagcagctttgcagagaacaagggcaggcattccggcggcgacagtt
tctattccaacaaggtatgttcacaccccaagtgaaacggtgtgtttagacgatgtggaa
cataccgttgaacttttgatcgaatattcacagaagggagtgtaa

DBGET integrated database retrieval system