KEGG   Thermotoga thermarum: Theth_0146Help
Entry
Theth_0146        CDS       T01554                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tta  Thermotoga thermarum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tta00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tta00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tta00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(142351..143760)
Genome map
AA seq 469 aa AA seqDB search
MKISIIGAGSVRFALQLVGDIAQTEELSNDKTEVCLMDIDEERLNTSFVLAKKYACELGS
TINIQKTLSLDVAVDGADFIINTAYPYDRRYLKDGYERWDRVTEIGEKHGYYRGIDSREF
NMVSTYSYVLASYPDVMLALEIARKMEKLAPNAWLMQTANPVFDITQIVTRLTNVKIVGF
CHGVAGVYAVFEALELDPTKVDWQVAGVNHGIWLNRFLYEGKNAYELFDEWIKKKSKNWE
PKNPWDTQLSPAAIDMYKFYGMLPIGDTVRNGSWKYHYNLETKKKWYGKFGAIDNEVERP
RFHDAMREARKKMIELAKEVEKDPKIELTKIWPQVFRKGTLSGEQHIPFICAITYDKKTR
LVLNVLNNSSIEKLPKDLIVEVPVWVDKNGLRAEKIDPPLTDRIVYFYLYPKIIAMEFAY
EAIVSRDKNVLIEALIRDPRTKSYEQAVAVLDEIMEQPFNEEMRKYFNW
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatctccataattggtgcgggaagtgttagatttgccctgcagttggttggagac
atagcgcaaactgaagaactttcaaacgataaaactgaggtttgccttatggatatcgat
gaagaaaggcttaacacctcttttgtccttgccaaaaaatacgcttgtgagcttggttcg
acgataaacattcaaaaaaccctgtcacttgatgtagctgttgatggcgcagatttcata
atcaacactgcttatccttatgacagaagatatctcaaagacggttacgaacgttgggac
cgtgtaacagaaataggagagaaacatggatattatagaggtatagacagtcgcgagttc
aacatggtctcaacctattcttacgttttggcttcttatccagatgtgatgctggccttg
gaaatagctcgaaagatggaaaaattggcacccaacgcatggttgatgcaaactgcaaat
cctgttttcgacatcactcaaattgttacgagacttacaaacgtcaaaattgtaggtttt
tgtcatggtgtggctggagtctacgcagtattcgaagcccttgaacttgacccaactaaa
gtggattggcaggtagcaggtgtaaatcacggcatatggttaaacagatttctgtacgaa
ggaaaaaacgcatatgaacttttcgatgaatggatcaaaaagaaatcaaaaaactgggaa
ccaaaaaatccttgggatacgcaactttcaccagctgcaatagatatgtacaagttttat
ggaatgcttccgataggtgacaccgtcaggaatggctcgtggaaatatcattacaacctt
gagacaaagaaaaaatggtatggaaaatttggtgctatagataacgaagtggaaagacca
agatttcacgacgcaatgagagaggcaagaaagaaaatgatcgagcttgcaaaggaagtt
gagaaagatccaaaaatagaacttaccaaaatttggccacaggtttttagaaaaggaaca
ttaagtggtgaacaacatataccttttatatgtgccatcacatatgataaaaaaactaga
ttagttctaaacgttctgaacaattcctcaatagaaaaacttccgaaagatctcatagta
gaagttccagtttgggttgataaaaatggtttgcgagctgaaaaaattgatccccctttg
acagataggattgtgtatttttatttgtatccaaaaataatagcgatggaatttgcctat
gaagccatagtttcaagagataaaaatgtgttaattgaagcgttgataagagatccaaga
acgaaatcgtatgaacaagctgttgcagttctagacgaaatcatggaacaaccgttcaac
gaagaaatgagaaaatatttcaattggtga

DBGET integrated database retrieval system