KEGG   Thermotoga thermarum: Theth_0155Help
Entry
Theth_0155        CDS       T01554                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
tta  Thermotoga thermarum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theth_0155
   00052 Galactose metabolism
    Theth_0155
Enzymes [BR:tta01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Theth_0155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
154251..155351
Genome map
AA seq 366 aa AA seqDB search
MLKIFQNKLIQKNLFGLSSKGKSVYQYTLSSESGLVCKILNYGGTIKELWIPDKNGKLID
VVLGFDTLEEYEKFNSSYFFGSIIGRYANRIANGRFQIDNKIYQLPLNDGDRPNTLHGGL
NGFHSAVFDAAFEETNSKQAVLVLKYKSSDGEEGFPGNLDVTVTYTLADLQLVVEYFATT
DKPTVVNMTQHSYFNLSAKDTILDHYLVINGDFYTPVDENLIPTGEIKPVEGTALDFRKP
RKISDGISQILQEGFLGYDHNFVIKGKVGELRFAAALFEESTGICMEVYTTQPGLQLYTG
NYLSNVRGKHGRIYNRYAGLCLETQNFPDAPNHENFPSALLLPGQVYHHKTIYKFRYFDK
LPMNFE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaatattccaaaacaagctgattcagaaaaatttgtttggtctatcgtccaaa
ggtaaatctgtttatcagtataccttaagctctgaaagtggtttggtatgcaaaattcta
aattatggtggaacgatcaaagaactttggattccagataaaaatggcaaattgatcgat
gtagtcttgggcttcgatactttagaagaatatgaaaaatttaattcaagctacttcttt
ggcagtattattggaaggtatgcaaacagaatagcaaatggaaggtttcaaattgacaat
aaaatttatcaactgcctttgaacgatggtgataggcccaatacacttcacggcggatta
aatggttttcacagtgctgtttttgatgctgcttttgaggaaacaaattccaaacaagcg
gtgttagttttgaaatataaaagctcagatggtgaagagggtttcccaggaaatcttgat
gttactgtgacttacactcttgccgatttgcagcttgttgtggaatacttcgcgaccact
gacaaaccaacagttgtcaatatgacgcaacattcttatttcaacctatcggcaaaagac
actattttggatcactatttggttatcaatggtgatttctacacgcctgttgatgaaaat
ctgatcccaacaggtgaaataaaacctgttgaaggaaccgcacttgattttagaaaaccg
agaaaaatttcagatggtatatcgcaaatacttcaagaaggttttttagggtacgatcat
aactttgtcatcaaaggcaaagtgggcgaattgcgatttgcagctgctttatttgaggaa
agcaccggaatctgcatggaagtttatactacacaacctggtttgcaactttacactggt
aattacctgtcaaatgttcgtggcaagcatggtcgaatctacaacagatatgctggttta
tgtttagaaactcaaaactttccagatgcaccaaatcatgaaaattttccatccgctttg
ttgttacctggacaagtttatcatcacaaaacaatttataaatttagatattttgacaaa
ttgccgatgaattttgaataa

DBGET integrated database retrieval system