KEGG   Thermotoga thermarum: Theth_0156Help
Entry
Theth_0156        CDS       T01554                                 

Definition
D-xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tta  Thermotoga thermarum
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Theth_0156
   00051 Fructose and mannose metabolism
    Theth_0156
Enzymes [BR:tta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Theth_0156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
155373..156698
Genome map
AA seq 441 aa AA seqDB search
MKFFKEFPKIEYEGPTSTNPLSFKYYNPNEIIDGKSLKDHLKFSVAFWHTFVGAGSDMFG
DGTFDRPWNRFSDPMDRAFARIDALIEFCEKLGIEYFCFHDRDIAPEGKTLRETNQMLDK
VVNYLKERLKGTNLKLLWGTANLFSNPRYCQGAATSPCADVFAYAAAQVKKALEITKELG
GQGYVFWGGREGYETLLNTDMKLELDNLARFLSMAVDYAKKIGFNGQFMIEPKPMEPTKH
QYDFDAAHCLAFLKTYGLDPYFKFNIEANHATLAGHTFAHELRYARINGKFCSIDANQGD
LMLGWDTDQYPTNIYETTLAMYEVIKAGGFTTGGLNFDAKPRRASYTLRDLVLGHIVAMD
TFALGFKIAHRIIKDGKIDKIIEERYASYNEGIGLKIRNNQTNFEELEQYVLDKEVGVPA
SGRQEELEMMLNYYILTTVKC
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcttcaaggaatttccaaaaattgagtacgaaggtccaacaagtacaaatcct
ttgagttttaagtattataatccaaacgagatcatcgatggtaaatctttgaaagatcat
cttaaattttccgttgccttctggcatacctttgttggtgcaggcagtgacatgtttggc
gatggcacttttgataggccttggaatcgtttcagtgacccaatggacagagctttcgca
agaatagacgcgcttattgaattttgtgaaaagcttggtatcgaatatttctgttttcat
gatcgcgacatagctccagagggaaaaacactacgtgaaaccaatcagatgcttgacaaa
gttgtgaattatttaaaagaaaggcttaaaggaaccaatttgaaacttttgtggggaact
gcaaacttgttttctaaccctaggtactgccaaggtgctgccacatcaccttgcgcggat
gtttttgcctacgctgctgcgcaggttaaaaaggcacttgagatcaccaaagaacttgga
ggccaaggttacgtattctggggcggaagggaaggctatgaaactcttttgaacaccgac
atgaaactcgagcttgacaatcttgcaaggtttttgagtatggctgttgactatgcgaaa
aagataggtttcaacggccaattcatgattgaaccaaaaccaatggaaccgacaaagcat
cagtatgatttcgatgcagcacactgtttggcatttttgaaaacttatggtttggatcct
tacttcaaattcaacattgaagcaaaccatgcaaccttggcaggtcatacttttgcgcat
gaactaagatatgctagaataaatggtaaattctgtagtatcgatgcgaatcaaggtgat
ctaatgctggggtgggatactgatcaatatccaacaaatatctacgaaacaactttggca
atgtacgaagtaataaaagcgggaggatttacaacaggtggtttgaactttgatgcaaaa
ccaagaagggcatcgtacaccttacgtgatcttgtacttgggcacatcgttgccatggac
acctttgcactaggatttaaaattgcccataggattatcaaagatggaaagatagataaa
atcatagaagaaagatatgcaagttacaacgagggaataggtttgaaaataagaaacaac
caaacgaactttgaagaacttgagcaatacgttttggacaaagaagttggggtacctgct
tctggaaggcaggaagaacttgaaatgatgttgaattattacatccttacaaccgtaaaa
tgttga

DBGET integrated database retrieval system