KEGG   Pseudothermotoga thermarum: Theth_0333Help
Entry
Theth_0333        CDS       T01554                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tta  Pseudothermotoga thermarum
Pathway
tta00010  Glycolysis / Gluconeogenesis
tta00052  Galactose metabolism
tta00500  Starch and sucrose metabolism
tta00520  Amino sugar and nucleotide sugar metabolism
tta00521  Streptomycin biosynthesis
tta01100  Metabolic pathways
tta01110  Biosynthesis of secondary metabolites
tta01120  Microbial metabolism in diverse environments
tta01130  Biosynthesis of antibiotics
tta01200  Carbon metabolism
Module
tta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theth_0333
   00052 Galactose metabolism
    Theth_0333
   00500 Starch and sucrose metabolism
    Theth_0333
   00520 Amino sugar and nucleotide sugar metabolism
    Theth_0333
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Theth_0333
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Theth_0333
Enzymes [BR:tta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Theth_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Pan_kinase
Motif
Other DBs
NCBI-ProteinID: AEH50428
UniProt: F7YVC5
Position
331824..332702
Genome map
AA seq 292 aa AA seqDB search
MNKVIGIDIGGTMIKGGIVEEKIIKTRIIQPLAKKQPMESLDSVIKKLLRAGYEQIKCIG
IATAGRVDSDDGVVLYASPNIPNWSSLQLSKILRKRYDIPCYVINDAKAAALAEAKIRNV
SNLVLLTIGTGLGGGIIVNGEILQGFKWEAGEIGHTILHPNGRQCNCGKKGCAEQYISMK
VLHRYAKERDRHRLIERFHQNDLQIVSAVERLVKDLVILTDKLFLTIDPEFVVIGGGFCE
LGSNVLEIIRKHLEPYASKSLYSPSQVDLSTLGNDAGIIGAAMYAESRISGG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttataggcatcgacattggtggcactatgatcaaaggtgggattgtcgaa
gaaaagattataaaaacgaggattatccaaccactggctaagaagcaacctatggagagt
ttggattcagtaataaagaaactccttagagctgggtatgagcaaatcaaatgtattggt
atagctacagctggtagagtcgactcggacgatggtgttgttctttatgcgtcaccgaat
attcctaattggtcaagcttgcaactatcaaaaatcctgaggaaaagatatgatatacca
tgctacgttattaatgatgctaaggctgctgctttggcagaagctaaaatccgaaacgtg
tcgaacctggtcctgctgacaattggcacggggttgggtgggggaataattgtcaacggg
gaaattcttcagggtttcaaatgggaagctggggaaattgggcacactatacttcatcca
aacggcaggcaatgcaactgcggaaaaaaaggttgtgccgagcagtacatatcgatgaag
gttctgcacaggtatgcgaaagaaagggacaggcacagactcatagaaaggtttcatcag
aatgatctgcaaattgtttcagcggtagaaagattggttaaggacctggtcattttgaca
gacaaattatttttaacaattgatcctgagtttgtagtaatcggtggaggtttttgtgaa
ttaggatcaaatgtgttagaaatcatcaggaaacacctagaaccctacgcttcaaagtcc
ctttacagtccatcacaagttgatctgtcaactcttggaaatgatgctggtataattggt
gcagctatgtacgctgaaagtcgaatctcgggaggttga

DBGET integrated database retrieval system