KEGG   Thermotoga thermarum: Theth_0392Help
Entry
Theth_0392        CDS       T01554                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tta  Thermotoga thermarum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Theth_0392
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theth_0392
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Theth_0392
Enzymes [BR:tta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Theth_0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(388624..389685)
Genome map
AA seq 353 aa AA seqDB search
MAYLGVIDRYFDFLPVKKRESIVTLKEGNTPLIRASNLEKHLGLSFELYLKYEGMNPTGS
FKDRGMTVAISVAVENGATAVICASTGNTAASAAAYAARAGLKCAVLIPKDAVAIGKLAQ
AIAYGAKVIAVEGNFDDALKLVREFSEKFPVTVVNSINPNRIEGQKTAAFEICDEFLDAP
DYLAIPVGNAGNITAYWKGFKEYFSIGKISKLPKMLGFQAAGAAPIVEGRIIENPKTIAT
AIRIGNPASWKSAVNAVQESCGLVDKVTDEEILQAYQLLAKKEGIFVEPASAASVAGVIK
YFNKGYFQKNSKVVCVLTGHGLKDPDTAMKIGISPVVIPPEIKALEKAIYDGE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacttgggtgttattgacagatactttgattttttaccagttaagaaaagagaa
agtatagtgacgctaaaagaaggaaatactcctcttatcagggcttctaacttggaaaaa
catcttggtttgagctttgaactgtatctgaaatacgaaggaatgaatccaacaggttcg
ttcaaagacagggggatgacagtggcaatatcagtcgcggtggaaaacggtgcaacagct
gtgatttgcgcttcaactggtaacacagctgcttctgcagctgcttatgctgcacgtgct
gggctgaaatgcgcagttttgataccaaaagatgccgttgcaatcggtaagcttgcacaa
gcgattgcttacggagcaaaagtaattgccgtggaaggaaatttcgacgacgctttgaaa
ctggttagagaattttcagagaaatttccagtaactgtcgttaactcgataaaccctaac
agaatagagggacaaaaaactgctgcgtttgaaatatgcgatgaatttttagacgcccct
gattaccttgccatacccgttggtaatgcaggaaacataaccgcttattggaaagggttc
aaagagtatttttccattggaaaaatttcaaaacttccaaaaatgcttggttttcaagct
gctggtgctgcgcctatagtggaaggaaggataattgaaaacccaaaaacaatagcgaca
gccataagaataggtaatcctgctagctggaaatccgctgtcaacgcagttcaagaatcc
tgtgggcttgttgacaaggtgacggatgaagaaatccttcaagcttatcaacttttagcg
aagaaagaaggcatctttgtcgaaccagcttcagccgcatcagttgcaggtgttataaag
tacttcaacaagggatactttcaaaaaaattccaaggtcgtttgtgttttaacaggtcat
ggtttgaaagatcccgatactgccatgaaaattggaatatcaccagttgtgatacctcca
gaaatcaaagccttggaaaaagccatatacgatggggagtga

DBGET integrated database retrieval system