KEGG   Pseudothermotoga thermarum: Theth_0485Help
Entry
Theth_0485        CDS       T01554                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tta  Pseudothermotoga thermarum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Theth_0485
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theth_0485
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Theth_0485
Enzymes [BR:tta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Theth_0485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
480059..481237
Genome map
AA seq 392 aa AA seqDB search
MNRYFGRFGGMYAPETLMPALLEIEKQFCELINREDFLNEYNYYLKYYVGRPSPLYYAKN
LSNYLNVKIYLKREDLNHTGAHKINNCIGQALLAKYMKKTRLIAETGAGQHGVATATVAA
LFGMECEIFMGEEDAKRQFHNVQRMKMLGSKVRIVSKGSKTLKDAINEAMRDWSETFEYT
FYVFGTAAGPHPFPTIVKYFQSVVGREAKQQILELEGRLPDYVFACVGGGSNAIGIFSAF
IDDPQVKLVGVEGAGEGVETKRTAATLCSGSVGILHGAKTYVLQDEEGQIQITHSISAGL
DYPGVGPEHAYLKEIGRVEYVGIRDEEAVEAFLLLTRLEGIIPALESSHALAEVIKRAKA
GFFKPSDVVIVNLSGRGDKDINTVLKWKGDEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggtactttggaagatttggtggtatgtacgcacctgaaacgttgatgccagca
cttttggaaatcgaaaaacagttctgcgaacttataaacagagaggattttctaaacgag
tacaattattatctcaaatactatgttggtagaccttctccgctttattacgcgaaaaac
ttaagcaactatctcaacgtaaagatctacctaaaaagggaagatttgaaccacactgga
gctcacaaaatcaacaattgcattggacaagctttacttgcaaagtacatgaaaaaaact
agattgattgctgaaaccggtgcaggacaacatggtgttgcaaccgctacagtcgctgca
ctgttcggtatggagtgtgagatattcatgggtgaggaagatgcaaaaagacaatttcac
aacgttcaaaggatgaagatgcttggaagcaaggtgcgaatcgtcagcaagggaagtaaa
actttgaaggatgccataaacgaagcgatgcgcgattggagcgaaacttttgagtacact
ttctacgtctttggtacggcggctgggccacatccgtttccaacgatagtgaaatacttt
caaagtgtagttggaagagaggcaaaacaacaaatacttgaattggaaggaaggcttccc
gactatgtatttgcctgtgttggaggaggatcgaatgcgataggaattttttccgcgttc
atagatgatccgcaggtgaaactcgtcggagttgagggggcgggtgaaggagttgaaaca
aagagaactgccgccactctttgcagtggttctgttgggattttacatggagcaaaaacg
tacgttctacaggatgaagaaggacaaattcagattacccattccatttcagctggtctt
gactatcctggagttggacctgagcacgcttatttaaaagagattgggagagttgaatac
gttgggattcgtgatgaagaagcggtagaagccttcctgcttttaacaaggttggaggga
ataattcctgcacttgaaagtagtcatgctttagcggaagtcataaaaagagctaaggcg
ggattttttaaaccttcagatgttgtgattgtcaatttgtctggaagaggggataaagat
attaacactgtacttaagtggaaaggtgatgaagtatga

DBGET integrated database retrieval system