KEGG   Pseudothermotoga thermarum: Theth_0485Help
Entry
Theth_0485        CDS       T01554                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tta  Pseudothermotoga thermarum
Pathway
tta00260  Glycine, serine and threonine metabolism
tta00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tta01100  Metabolic pathways
tta01110  Biosynthesis of secondary metabolites
tta01130  Biosynthesis of antibiotics
tta01230  Biosynthesis of amino acids
Module
tta_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theth_0485
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Theth_0485
Enzymes [BR:tta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Theth_0485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEH50577
UniProt: F7YWY5
Position
480059..481237
Genome map
AA seq 392 aa AA seqDB search
MNRYFGRFGGMYAPETLMPALLEIEKQFCELINREDFLNEYNYYLKYYVGRPSPLYYAKN
LSNYLNVKIYLKREDLNHTGAHKINNCIGQALLAKYMKKTRLIAETGAGQHGVATATVAA
LFGMECEIFMGEEDAKRQFHNVQRMKMLGSKVRIVSKGSKTLKDAINEAMRDWSETFEYT
FYVFGTAAGPHPFPTIVKYFQSVVGREAKQQILELEGRLPDYVFACVGGGSNAIGIFSAF
IDDPQVKLVGVEGAGEGVETKRTAATLCSGSVGILHGAKTYVLQDEEGQIQITHSISAGL
DYPGVGPEHAYLKEIGRVEYVGIRDEEAVEAFLLLTRLEGIIPALESSHALAEVIKRAKA
GFFKPSDVVIVNLSGRGDKDINTVLKWKGDEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggtactttggaagatttggtggtatgtacgcacctgaaacgttgatgccagca
cttttggaaatcgaaaaacagttctgcgaacttataaacagagaggattttctaaacgag
tacaattattatctcaaatactatgttggtagaccttctccgctttattacgcgaaaaac
ttaagcaactatctcaacgtaaagatctacctaaaaagggaagatttgaaccacactgga
gctcacaaaatcaacaattgcattggacaagctttacttgcaaagtacatgaaaaaaact
agattgattgctgaaaccggtgcaggacaacatggtgttgcaaccgctacagtcgctgca
ctgttcggtatggagtgtgagatattcatgggtgaggaagatgcaaaaagacaatttcac
aacgttcaaaggatgaagatgcttggaagcaaggtgcgaatcgtcagcaagggaagtaaa
actttgaaggatgccataaacgaagcgatgcgcgattggagcgaaacttttgagtacact
ttctacgtctttggtacggcggctgggccacatccgtttccaacgatagtgaaatacttt
caaagtgtagttggaagagaggcaaaacaacaaatacttgaattggaaggaaggcttccc
gactatgtatttgcctgtgttggaggaggatcgaatgcgataggaattttttccgcgttc
atagatgatccgcaggtgaaactcgtcggagttgagggggcgggtgaaggagttgaaaca
aagagaactgccgccactctttgcagtggttctgttgggattttacatggagcaaaaacg
tacgttctacaggatgaagaaggacaaattcagattacccattccatttcagctggtctt
gactatcctggagttggacctgagcacgcttatttaaaagagattgggagagttgaatac
gttgggattcgtgatgaagaagcggtagaagccttcctgcttttaacaaggttggaggga
ataattcctgcacttgaaagtagtcatgctttagcggaagtcataaaaagagctaaggcg
ggattttttaaaccttcagatgttgtgattgtcaatttgtctggaagaggggataaagat
attaacactgtacttaagtggaaaggtgatgaagtatga

DBGET integrated database retrieval system