KEGG   Pseudothermotoga thermarum: Theth_0486Help
Entry
Theth_0486        CDS       T01554                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tta  Pseudothermotoga thermarum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Theth_0486
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theth_0486
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Theth_0486
Enzymes [BR:tta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Theth_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
481234..482001
Genome map
AA seq 255 aa AA seqDB search
MNLIEEKFDQLKEKGEKAFIGYVTFGYPSFVETLDFINIVYSYVDILEIGFPFSDPIADG
EIIQKASVKALSEGVKLNDLFRSLGHIKKDKPIVLMLYANLVHRMGEDNFYKLCELNGVD
GIIIPDVPYEESFQFRQAADKHHVVYIDLVSVSSLERAKTIAIKSQGFLYCVSRKGVTGF
KGEMDDKLHIFLKELRKVTTTPLVVGFGIKNTNDVLKIKDLVDGVVIGSAIIAKMDEGKE
QLENFLKEIRYVLKN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgatagaggaaaaatttgaccaacttaaagaaaaaggcgaaaaagcgttcatc
ggttatgtcacgtttggctatccatcgttcgttgaaacgttggatttcataaacattgtt
tattcttacgttgacattttggaaataggttttccattctcagatccaatagcagatggc
gagataattcaaaaagcatcggttaaagctctttcagaaggtgtcaagttgaacgacctt
ttcagaagcttaggtcacatcaagaaagataaaccgatcgtgttgatgttgtatgccaac
cttgttcacagaatgggcgaggataacttttacaaactttgtgagttgaacggagttgat
ggaataataattccggatgtaccttatgaggagagttttcaattcaggcaagctgctgac
aagcatcatgtagtttacatagatcttgtttctgtatcttctcttgaaagggcaaaaacg
atagcaatcaaaagtcaaggttttctttactgcgtatcgagaaaaggtgtaacaggcttt
aaaggagagatggatgacaaacttcacatttttcttaaggagctcaggaaagttacaacc
actccgttggtggttggttttggtattaaaaatacaaacgatgttttgaagatcaaagac
cttgttgacggagttgtcatcggaagcgcaataattgcgaaaatggatgagggtaaagaa
cagcttgagaatttcttaaaggaaattaggtatgttttgaaaaattga

DBGET integrated database retrieval system