KEGG   Thermotoga thermarum: Theth_0533Help
Entry
Theth_0533        CDS       T01554                                 

Definition
alpha/beta hydrolase domain-containing protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tta  Thermotoga thermarum
Brite
Enzymes [BR:tta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Theth_0533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
536585..537358
Genome map
AA seq 257 aa AA seqDB search
MLMLKRIPKDTVLQGEICKPLFVKKDPVGVLLIHGYTGSPHDMRYLAEKLVERGFTVSVP
RLPGHGTNHMDFLSTNHRDWLRRAIDAHIELRTECEKVHVVGLSMGGLLAAILATKFEVE
KLVLAAPAFVVSDKRVYITPILALFKDYLPREERVEYEDPVLKKLGSEYWNKNFTKPAVS
FLKLKRLATRLLGQVRSKTLLIIARNDSVVPMEVREFVEKRVKGPIETVVLEKSNHVVVN
DVEKEYVAQLVAKFLEE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttgcttatgctcaaaaggataccaaaagataccgtgcttcaaggtgaaatctgcaagcct
ttgtttgtgaaaaaagatccagttggggttcttttgatccacggttatactggaagtcca
cacgacatgagatatcttgccgaaaagctcgtagaacgtggcttcaccgtttcagtccca
agactcccaggccatgggaccaaccacatggactttttgagcaccaaccacagagattgg
cttagaagggcgatagatgctcatatagagttgaggacagaatgtgaaaaagttcatgtt
gttggattgtcaatgggagggttgcttgccgcaatcttagccacaaagtttgaggttgag
aagttagttttagcagccccagcgttcgtggtttcggataaaagggtatacataacacca
atattggctttgttcaaagattatctaccaagagaagaaagggttgagtacgaagatcct
gttttgaaaaagttgggaagcgagtattggaataaaaacttcacaaaaccagccgttagc
tttttgaagctcaaaagacttgccacacggttacttggacaagttcgctcgaagactctt
ttgataatcgctcgaaacgattccgtggtgccaatggaagtgagggaattcgtggaaaag
agagtcaaaggaccaattgaaacagttgtgttggaaaaaagcaatcatgtggttgtgaac
gatgtggaaaaggaatacgtagcgcagttggttgcgaaatttttggaggaatga

DBGET integrated database retrieval system