KEGG   Pseudothermotoga thermarum: Theth_0581Help
Entry
Theth_0581        CDS       T01554                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tta  Pseudothermotoga thermarum
Pathway
tta00010  Glycolysis / Gluconeogenesis
tta00051  Fructose and mannose metabolism
tta00562  Inositol phosphate metabolism
tta01100  Metabolic pathways
tta01110  Biosynthesis of secondary metabolites
tta01120  Microbial metabolism in diverse environments
tta01130  Biosynthesis of antibiotics
tta01200  Carbon metabolism
tta01230  Biosynthesis of amino acids
Module
tta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tta_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theth_0581
   00051 Fructose and mannose metabolism
    Theth_0581
   00562 Inositol phosphate metabolism
    Theth_0581
Enzymes [BR:tta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Theth_0581
Exosome [BR:tta04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Theth_0581
  Exosomal proteins of bladder cancer cells
   Theth_0581
  Exosomal proteins of melanoma cells
   Theth_0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEH50669
UniProt: F7YXM6
Position
complement(584906..585634)
Genome map
AA seq 242 aa AA seqDB search
MNKTNQQAKLFVNELIQSLAGMKFEIVLCPPFVCLTDVKELLAGTNIKLGAQNCYYEQFG
AFTGEVSPAMLKEIGVEYVIVGHSERRHIFQETDELINKKVKAVLKNGMKPILCVGETKE
EREKGLTFCVVELQVRQGLYGVTKEEVRNVVIAYEPVWAIGTGIVAKPWQAQEVQRFIRQ
LLAELYDEETANSVPILYGGSIKPDNFLSLILKPDIDGGLVGGASLDRQFIELAKIVSKV
IY
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaccaatcaacaggcaaaactttttgtgaatgaattgattcaaagcttggcg
ggcatgaagtttgaaatagtcttgtgcccgccatttgtttgtttaaccgatgttaaggag
ttacttgctggcacgaatataaaacttggggcgcaaaactgctactacgaacaatttggc
gctttcactggagaagtctctccggcaatgttgaaagaaataggtgttgaatacgtgata
gttggacactctgaaagacgtcacatctttcaggaaactgatgaacttataaacaagaaa
gtcaaagccgttttgaaaaatggcatgaaaccgatcttgtgtgttggagaaacaaaagaa
gaaagggagaaagggttgacattttgcgttgttgaattgcaggtaagacaaggattgtac
ggtgttacaaaagaagaggtgcgaaacgttgttatagcctacgaaccagtttgggcaata
ggaactggaatagttgcaaaaccatggcaagcccaggaagtacaaaggttcattcgccag
ttacttgcggaactttacgatgaagaaacagcaaattctgttccaattttatacggaggc
agtataaaacccgacaacttcctgagtctcatacttaaacccgacatagacggtgggtta
gttggtggagccagtttggatcgccagttcatcgaacttgcaaagatagtttcgaaggtt
atatattga

DBGET integrated database retrieval system