KEGG   Thermotoga thermarum: Theth_0581Help
Entry
Theth_0581        CDS       T01554                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tta  Thermotoga thermarum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theth_0581
   01230 Biosynthesis of amino acids
    Theth_0581
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theth_0581
   00051 Fructose and mannose metabolism
    Theth_0581
   00562 Inositol phosphate metabolism
    Theth_0581
Enzymes [BR:tta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Theth_0581
Exosome [BR:tta04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Theth_0581
  Exosomal proteins of bladder cancer cells
   Theth_0581
  Exosomal proteins of melanoma cells
   Theth_0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(584906..585634)
Genome map
AA seq 242 aa AA seqDB search
MNKTNQQAKLFVNELIQSLAGMKFEIVLCPPFVCLTDVKELLAGTNIKLGAQNCYYEQFG
AFTGEVSPAMLKEIGVEYVIVGHSERRHIFQETDELINKKVKAVLKNGMKPILCVGETKE
EREKGLTFCVVELQVRQGLYGVTKEEVRNVVIAYEPVWAIGTGIVAKPWQAQEVQRFIRQ
LLAELYDEETANSVPILYGGSIKPDNFLSLILKPDIDGGLVGGASLDRQFIELAKIVSKV
IY
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaccaatcaacaggcaaaactttttgtgaatgaattgattcaaagcttggcg
ggcatgaagtttgaaatagtcttgtgcccgccatttgtttgtttaaccgatgttaaggag
ttacttgctggcacgaatataaaacttggggcgcaaaactgctactacgaacaatttggc
gctttcactggagaagtctctccggcaatgttgaaagaaataggtgttgaatacgtgata
gttggacactctgaaagacgtcacatctttcaggaaactgatgaacttataaacaagaaa
gtcaaagccgttttgaaaaatggcatgaaaccgatcttgtgtgttggagaaacaaaagaa
gaaagggagaaagggttgacattttgcgttgttgaattgcaggtaagacaaggattgtac
ggtgttacaaaagaagaggtgcgaaacgttgttatagcctacgaaccagtttgggcaata
ggaactggaatagttgcaaaaccatggcaagcccaggaagtacaaaggttcattcgccag
ttacttgcggaactttacgatgaagaaacagcaaattctgttccaattttatacggaggc
agtataaaacccgacaacttcctgagtctcatacttaaacccgacatagacggtgggtta
gttggtggagccagtttggatcgccagttcatcgaacttgcaaagatagtttcgaaggtt
atatattga

DBGET integrated database retrieval system