KEGG   Thermotoga thermarum: Theth_0713Help
Entry
Theth_0713        CDS       T01554                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tta  Thermotoga thermarum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theth_0713
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theth_0713
   00052 Galactose metabolism
    Theth_0713
   00500 Starch and sucrose metabolism
    Theth_0713
   00520 Amino sugar and nucleotide sugar metabolism
    Theth_0713
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Theth_0713
   00524 Butirosin and neomycin biosynthesis
    Theth_0713
Enzymes [BR:tta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Theth_0713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(713104..714048)
Genome map
AA seq 314 aa AA seqDB search
MKVIGIDLGGTNFAVGVVDEQGKILAKEQGKTLVQEGPDAVIKRLNQAVKNVLSNYEVEA
IGVGCPGSIDHKLGVVRFSPNFPGWHDFPLAEKLSLETGLKVYVENDANAYALGEHTFGV
GKGYDHIVCLTLGTGVGGGVITHGILLRGSSGIGAELGHVTVMPNGPTCGCGAKGCLEAF
ASATALKRFVQEGYERHKDSLLFHGKKPSEVSPEDIFRCAEQGDEFAKSIISLLTDALAV
AIGSFVNIFNPQLVILGGGISNAGEKLLKPVAEKVKDHVLPSMLGTFEIKLSKLGKDAGI
LGAASIVFERMNKT
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggttatcggaatagacctgggtggaacgaactttgcggttggtgttgttgacgaa
caaggtaaaattctggcaaaagaacaaggcaaaacgctggtgcaagaaggtcctgatgct
gtgataaagcgtttaaatcaagcggtgaaaaacgttctttcaaactacgaagttgaagca
ataggagttggatgtcctggaagtattgaccataagttaggagttgttagattttccccc
aattttcctggttggcatgattttccgctggcagaaaagctatcacttgaaactggtttg
aaagtctatgtcgaaaacgatgcaaacgcttatgctttaggtgaacatacgtttggtgtg
ggaaaaggatacgatcacatagtttgcttaacgcttggaacaggtgttggtggaggagtt
ataactcatgggattcttcttagaggtagcagtggcataggagcagaattaggccatgtc
acggttatgcccaacggtcctacctgtggttgcggtgcaaaaggatgtctagaagctttt
gcatcagccacggctttaaaaagatttgttcaagaaggatacgaaaggcacaaagactca
ctgcttttccacggaaaaaagccaagcgaagtttcccctgaggatatctttcgatgtgcc
gagcaaggcgatgagtttgcaaaaagtataatttcccttttaaccgacgctttagccgtt
gcaataggaagttttgtaaacattttcaacccccaattggtgatactcggtggtggtatt
tcaaacgcaggtgaaaagttgttaaaacccgtcgctgaaaaagttaaagaccacgtttta
ccaagcatgttgggcacctttgaaataaagctcagcaagcttggaaaagacgcaggaata
cttggagcagcatcgattgtttttgagaggatgaataaaacgtga

DBGET integrated database retrieval system