KEGG   Thermotoga thermarum: Theth_0760Help
Entry
Theth_0760        CDS       T01554                                 

Definition
pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase family
Organism
tta  Thermotoga thermarum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
745596..746552
Genome map
AA seq 318 aa AA seqDB search
MKISLARLPTPIEYLARLSKQYGREIFVKRDDLTEFISSGNKIRKLEFLLADALKNGCNM
VFTCGGIQSNHARATAHLAVKLGLKPVLFLRQPATVDKELINGNLLLDELLGATIIPVTT
QQYAKIEEIYEEYKKDYESRGYKVYTIPEGGSNSLGALGYLFAVAEIATQIDLSTVDAIY
CAVGSGGTYAGLIAGLRYLGYKTPVVGINVTKTKAERFVEKIEEIIAGMSQFGVDVKVSS
EEIIILDEYSGPDYAVPSDADIDCIRIVASTEGIVLDPVYTAKAFRGMLQNSRRSQRLLF
IHTGGTFGIFAQAFRFAH
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttcactggcaagattgccaacgccgatagagtatttagctaggttgagtaag
caatatggaagagagatatttgttaagcgtgacgatctaactgaattcatttcaagtgga
aataagataagaaagctggaatttcttcttgccgatgctctcaaaaacggctgcaacatg
gtctttacctgtgggggtatccagtcaaaccacgcaagagccactgctcatttggctgtg
aaacttgggttgaagcccgttttgtttttacgccaacctgcaaccgttgacaaagaactg
atcaacgggaatttacttttggacgagcttcttggtgccacgataatacctgtgacgact
caacagtacgcaaagattgaagaaatctacgaggaatacaagaaagattacgaatcaagg
ggttacaaggtttacacgattcccgagggaggctctaacagccttggtgcacttggttat
ctttttgcagttgcggagattgccacacaaattgatttgtcaaccgtcgatgccatttat
tgtgcggttggcagcgggggaacttacgcaggtttgattgccggcctcaggtaccttgga
tacaaaacacctgttgtaggaataaacgtcacgaaaacaaaagccgaaaggtttgtcgag
aagatagaggaaataatcgccggtatgtcacagtttggtgttgacgttaaggtttcttct
gaagagataatcatactcgatgaatatagcgggcctgactacgccgttccaagcgatgcc
gatatcgattgtataagaattgttgcttccacagaaggcattgtactcgatccagtttac
acagcaaaagctttccgaggtatgttgcaaaattctagaagatcacaaagactgcttttc
atacacacagggggtactttcggaatttttgcccaagctttcaggtttgcacattga

DBGET integrated database retrieval system