KEGG   Thermotoga thermarum: Theth_0760Help
Entry
Theth_0760        CDS       T01554                                 

Definition
(RefSeq) pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase family
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
tta  Thermotoga thermarum
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Theth_0760
Enzymes [BR:tta01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Theth_0760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
745596..746552
Genome map
AA seq 318 aa AA seqDB search
MKISLARLPTPIEYLARLSKQYGREIFVKRDDLTEFISSGNKIRKLEFLLADALKNGCNM
VFTCGGIQSNHARATAHLAVKLGLKPVLFLRQPATVDKELINGNLLLDELLGATIIPVTT
QQYAKIEEIYEEYKKDYESRGYKVYTIPEGGSNSLGALGYLFAVAEIATQIDLSTVDAIY
CAVGSGGTYAGLIAGLRYLGYKTPVVGINVTKTKAERFVEKIEEIIAGMSQFGVDVKVSS
EEIIILDEYSGPDYAVPSDADIDCIRIVASTEGIVLDPVYTAKAFRGMLQNSRRSQRLLF
IHTGGTFGIFAQAFRFAH
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttcactggcaagattgccaacgccgatagagtatttagctaggttgagtaag
caatatggaagagagatatttgttaagcgtgacgatctaactgaattcatttcaagtgga
aataagataagaaagctggaatttcttcttgccgatgctctcaaaaacggctgcaacatg
gtctttacctgtgggggtatccagtcaaaccacgcaagagccactgctcatttggctgtg
aaacttgggttgaagcccgttttgtttttacgccaacctgcaaccgttgacaaagaactg
atcaacgggaatttacttttggacgagcttcttggtgccacgataatacctgtgacgact
caacagtacgcaaagattgaagaaatctacgaggaatacaagaaagattacgaatcaagg
ggttacaaggtttacacgattcccgagggaggctctaacagccttggtgcacttggttat
ctttttgcagttgcggagattgccacacaaattgatttgtcaaccgtcgatgccatttat
tgtgcggttggcagcgggggaacttacgcaggtttgattgccggcctcaggtaccttgga
tacaaaacacctgttgtaggaataaacgtcacgaaaacaaaagccgaaaggtttgtcgag
aagatagaggaaataatcgccggtatgtcacagtttggtgttgacgttaaggtttcttct
gaagagataatcatactcgatgaatatagcgggcctgactacgccgttccaagcgatgcc
gatatcgattgtataagaattgttgcttccacagaaggcattgtactcgatccagtttac
acagcaaaagctttccgaggtatgttgcaaaattctagaagatcacaaagactgcttttc
atacacacagggggtactttcggaatttttgcccaagctttcaggtttgcacattga

DBGET integrated database retrieval system