KEGG   Thermotoga thermarum: Theth_0993Help
Entry
Theth_0993        CDS       T01554                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tta  Thermotoga thermarum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Theth_0993
Enzymes [BR:tta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Theth_0993
Exosome [BR:tta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Theth_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(968300..969802)
Genome map
AA seq 500 aa AA seqDB search
MVAEKYVLALDQGTTSSRAIIFDKNGSVVSVANQEFPQIYPKPGWVEHDPIDILESQISV
AKKAMRQADIEADQIVAIGITNQRETTIVWDKKTGKPIHNAIVWQCRRTADICEKLKQSE
WGEKIKKKTGLVVDAYFSATKLKWILDNVPGAREKAKAGELLFGTVDSWLIWNLTGGKIH
VTDFSNASRTMLFNIHNLKWDEELLELLEIPRQMLPEVLPSSYIYGYTVKEIFGVQIPIG
SDAGDQQAALFGQLCCEPGMVKNTYGTGCFLLMNTGKTAVSSESGLLTTIAWSLDGKEVC
YALEGSVFIAGAAIQWLRDGLRIIAKASDTEYMANSVADSGGIYFVPAFVGLGAPYWDMF
ARGTIVGITRGITREHIVRATLESIAYQTRDVLEAMEKDSKMKINTLRVDGGASVNNFLM
QFQADILGIPVERPKVNETTALGAAYLAGLAVGFWENMDQIKQQWQLDKKFEPTLPEKER
ERLYAGWKKAVSRAMRWAEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtggtggctgaaaagtatgttcttgcattggatcagggtacaacaagttcaagagcgatt
atcttcgataaaaacggttctgtggtttcggtagcaaaccaggaatttccacagatttat
ccaaagccaggttgggttgaacacgatccaatagacatccttgaatctcaaataagcgtt
gccaagaaggcaatgagacaagcagatatagaggcagatcaaattgttgcaattgggatt
acaaaccagcgcgaaacaacgattgtttgggataagaaaacaggcaaaccaattcacaat
gccatagtttggcaatgcagaagaacagcagatatatgtgaaaaacttaagcaaagtgag
tggggcgagaagatcaaaaagaaaacaggcttggtcgtggacgcatacttttcggccacc
aagctgaaatggattctcgacaacgtacctggtgcaagagaaaaggcaaaggcaggagaa
ttgctctttggaacggtggatagttggttgatttggaatctaaccggtgggaaaattcac
gttactgatttttcaaacgcatcaagaactatgttattcaatattcacaatttgaagtgg
gatgaagaactgttagaacttcttgaaatacctcgtcaaatgctgccagaggttctccct
tcttcatatatttatggttatactgtaaaggaaatttttggcgttcagataccaattggt
tcagacgcaggtgatcagcaggcagcgctgtttggacaactttgttgtgaacctgggatg
gttaagaatacttatggtacaggatgtttcttgctcatgaacactggtaagaccgcggtt
agctctgaatcaggtttgttgacaacaattgcctggagtcttgatggtaaagaagtttgc
tatgctctggaaggaagtgtattcatcgcaggagcagctatacaatggttaagagatggg
ctaagaattattgcaaaagcttcggatactgaatatatggcaaattctgtagcagattca
ggtgggatttattttgttccagcctttgtgggtcttggtgcaccttattgggatatgttt
gcaagaggaacgattgttggaatcacaagaggtataacacgagaacacatagttagagca
acactcgagtcaatagcttatcaaactagagatgtccttgaagcaatggaaaaagattca
aaaatgaagattaacactttaagagttgatggtggcgcttcggtcaacaactttttgatg
caatttcaagctgatatacttggaattcctgtggaaagacctaaagtaaatgaaaccaca
gcccttggtgcagcatatttggctgggctagcagttggtttttgggaaaatatggatcaa
ataaagcaacaatggcaacttgataaaaaatttgaaccaaccttgccagagaaggaaaga
gaaagactttacgctggctggaagaaagctgtctcaagagccatgaggtgggctgaagaa
tga

DBGET integrated database retrieval system