KEGG   Thermotoga thermarum: Theth_1019Help
Entry
Theth_1019        CDS       T01554                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tta  Thermotoga thermarum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tta01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tta00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
997184..998974
Genome map
AA seq 596 aa AA seqDB search
MYRMLEIDLSTGLTKVSDLTELFKTFIGGTGVLTYLASQELTNQLNPFSPDAPIYFAIGP
FNGYFPTASKAVAIFKSPLTGDLGESHAGGRFWMEMLAAGFHVIKIKGQAPEPVYLSIDN
EEVRVVSAKALWGMSTLATERILREREDARKGKKSILRIGPAGERLSPIACVVVDSSRHF
GRLGLGAVMGSKNLKTIVISGNRYPKIENKRQYQVLYEKIFKELVSSETTYKYRDLGTAA
NVLPLSKIYGLPTRNFSQGIFESAYRISGEYFADNYLAQQISCAHCPVGCIHVAVHRELF
SDPHMFKHAKVSYDHELIYSLGSNLGIADAGQVLKLIQFVEKQGWDAISIGVVLAWATEA
FQQGVITLKETETPLSFGDFEAYMKTLSFIAEGKNEFYRDLEKGVYYCAEKYGGKEFAMH
FNKNEAPGYMTGPDAFVGYAVGVRHSHLDCAGYSIDQKYLGRQADIEKEVKAMHDEATWR
VVTNSLVTCLFARGTYTKEIVVECLKYLGYDFDEEKLLELGKIIHGMKFLVKHKLGFSFD
KLQLPKKLTKVYTSRGMIKEEDFIKRVELYKKLVEEDMEKAKEFLTNFSKNEDVRI
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtatagaatgcttgaaatagatttatcaactggcttgacaaaagtaagtgatttaaca
gaacttttcaaaactttcatcggaggaacgggtgttttaacgtatcttgccagccaagag
cttacaaatcagttgaatcctttttcaccggacgctcccatttattttgcaatagggcct
ttcaacggttattttccaacagcttcaaaagcagttgcaattttcaaatctccccttact
ggcgatttgggtgaatctcatgcaggcggaagattttggatggaaatgctggcagcaggt
tttcatgttatcaagatcaaaggtcaggctcctgaaccagtttatttgtcgattgacaat
gaagaagtaagagttgtttctgcaaaagcattgtgggggatgagcacccttgcgacagaa
agaattttaagagaaagggaagatgcaagaaaaggtaaaaagagtatcttgcgaataggt
ccagctggagaaagattatcaccgatagcttgtgttgtagtggattcttcaaggcatttt
ggacgtctcggacttggggccgtcatgggctcaaagaatttgaagacgatagttatctct
ggaaatagatatccaaagattgaaaataaaagacagtaccaagttttgtacgaaaaaatt
ttcaaagaacttgtttcttccgaaacaacttacaagtaccgtgaccttggaactgctgca
aacgttttaccgctttccaaaatctacggtcttccaacgagaaatttcagccaaggaatt
tttgaaagtgcttacagaataagcggagaatactttgcagacaattatctggcccaacaa
atttcttgcgcacattgtccagtcggttgtatacacgtcgctgttcacagagaacttttc
agcgacccacatatgttcaaacatgcaaaagtcagttacgatcacgaattgatatactcg
cttggttcaaaccttgggattgccgacgcaggacaagtgttgaaattgatacaatttgtc
gaaaaacaaggctgggacgcaatcagcataggtgtagtgctagcttgggctacagaggct
ttccagcaaggagttattacccttaaagaaacagaaacacctttgagttttggtgacttt
gaagcttacatgaagactttgagtttcatagcggaagggaagaacgagttttacagagac
cttgaaaaaggagtttattattgtgctgaaaaatacggcggaaaggagtttgcaatgcat
ttcaacaaaaacgaagcgccagggtacatgacaggtccagacgcctttgttggctatgcc
gttggggtcagacattcgcacttggattgtgccggttacagtatcgatcaaaagtacctt
gggagacaagctgatatcgagaaagaagtcaaagcaatgcacgacgaggcaacgtggcga
gtggttaccaacagcttggtgacttgtttgtttgcaagaggaacttacacgaaggaaatc
gttgtagaatgtttaaaataccttggatacgattttgacgaagaaaaactccttgagctt
ggaaaaatcattcatggaatgaagtttttggttaaacataaacttggcttcagcttcgat
aaactacaacttccaaagaaattgacaaaggtttatacctccaggggtatgattaaagaa
gaagatttcataaagcgagtggaactttacaaaaagcttgtcgaagaggatatggaaaaa
gcgaaagaatttctcacaaatttttcaaaaaatgaggatgtgagaatatga

DBGET integrated database retrieval system