KEGG   Thermotoga thermarum: Theth_1024Help
Entry
Theth_1024        CDS       T01554                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tta  Thermotoga thermarum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tta01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:tta00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1003029..1004330
Genome map
AA seq 433 aa AA seqDB search
MKITTAHDFFHFKTQSLTLNLFLEQEKIVRKIVEDVYINKDEALLRYTRHFDCPDFQYED
FVVKNEEIELAYEWCEKNDPEFLLAVKKAYENIECYHKNQLEKSWFYTTQNGSVLGQLIF
PLKRVGIYVPGGKASYPSTVLMCSIPAKVANVEEIVLVSPPNKQKKLNTYVLATAKICGI
DKIFKIGGAQAIAALAFGTDILPKVDKIVGPGNLYVALAKKIVFGIVDIDSIAGPSEVAI
VADESANPTFIAYDLLAQAEHDPLARTFLITTSKDLATEVSRQVEDILMAEPNEIARESI
ENQGLIILVEKLEQVVDVVEKIAPEHLELLCKGWEDLLVKIKSAGAIFVGEFSPEAIGDY
LAGPNHVLPTQGTARFFSPLGVYDFVKRTSLIKYSKSDFLKNHRHAVKIAYIEGLKFHAR
SLEVREKDVQEGA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataacaacggcacatgattttttccacttcaaaactcaaagcttgacgttgaat
ttgtttttggagcaggaaaaaattgttagaaagattgttgaggatgtttacatcaacaaa
gatgaggcattgttaaggtacacaaggcattttgattgtccagattttcaatacgaagat
ttcgttgtcaaaaacgaagagattgaattagcctatgaatggtgcgagaaaaacgatccc
gaatttttgttggctgttaaaaaggcttatgagaatatagagtgttatcacaaaaaccag
ctagaaaaaagttggttttacacaactcaaaatggatcagttttgggtcagcttattttt
ccattaaaacgtgtgggaatttatgtgcctggtggtaaggcaagttatccttctacagtt
ttaatgtgttcaattccggcaaaagtcgccaatgttgaagaaatcgttttggttagccct
cctaacaagcaaaaaaagttaaacacgtatgtacttgcgaccgcaaaaatttgtggaatt
gacaagattttcaaaataggtggtgcacaggctattgcagcccttgcttttgggacagat
atcttgccgaaggttgataaaatcgttgggcctggtaatttgtacgttgctcttgcaaaa
aagatcgtttttggaattgtcgatatcgattcaatcgcaggtccaagtgaagttgcaata
gttgcagatgaaagcgctaatccaaccttcatagcttatgatcttttggcacaggcagag
cacgatccattggcaagaacttttttgataacaacctcaaaagatctggcgacagaagtt
tcaagacaagttgaagatattctgatggccgaacccaacgagatagctcgcgaatcgatt
gaaaatcaaggattgataatcttggtcgaaaagctggaacaagtagttgatgtggttgaa
aaaatagctccagagcaccttgaattgctttgcaaaggctgggaggatttgctggtaaag
ataaaatcagctggggctatttttgttggagaattttcccccgaagcgatcggtgattat
ttagctggaccgaaccacgttcttccgactcaaggaacggctagattcttctcgccactt
ggtgtttacgattttgtcaaaagaacaagtttgataaaatattcaaaaagtgattttcta
aaaaaccacagacacgctgtcaaaatagcttatatcgagggtttgaaatttcacgcaaga
tctttggaagtgagggaaaaagatgttcaagaaggagcttga

DBGET integrated database retrieval system