KEGG   Thermotoga thermarum: Theth_1341Help
Entry
Theth_1341        CDS       T01554                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tta  Thermotoga thermarum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Theth_1341
Enzymes [BR:tta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Theth_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1334864..1335673
Genome map
AA seq 269 aa AA seqDB search
MIFGIGVDVLRIERVDEKLADKILGPHEKQEFEKTKDKKTYLASRFAAKEAFFKALGTGL
RNCFFKDVEFIHNKLGKPVLILHKDFEGFNLAHVSISHDFVVVAQVVLEKTTGGIYIGIG
SNLENRLKNIQNACLLMEKRQIQIVRKSSIYETKPYGKTDQPDFLNCVVEVETTLTPTRL
LENLLEIEKILGRVRTEKWGPRTIDLDILLYGNIVFETQNLTIPHYDLLNRQFFLVPLVE
LKVFHHPVEGDFSLKLKEGEECKLLTSNW
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgatctttggaataggcgttgacgtgttgagaatcgagcgagtcgatgaaaaactcgca
gacaaaatccttggaccgcacgaaaagcaagagtttgaaaaaacaaaggataagaaaacc
tatcttgcctcacgttttgcggcaaaggaagcctttttcaaagcacttggaacagggttg
agaaactgtttttttaaggacgttgaatttatccacaacaaacttggcaaacctgtgttg
atattgcacaaagactttgaaggctttaaccttgctcatgtttccatttcgcacgatttt
gtcgtcgtcgcacaagttgtccttgaaaaaacaacaggtggaatttacataggaatcggt
tcaaaccttgaaaataggttgaaaaacattcaaaatgcctgtttgctcatggaaaaacgt
caaattcaaattgtgagaaaatcttcgatctacgaaacaaaaccgtacggtaaaacagat
cagccagattttctcaactgcgttgtcgaagttgaaacaactctaacaccaacaaggttg
cttgaaaatctgcttgaaatagaaaaaattcttggaagggttagaaccgaaaagtgggga
ccaaggactatagatttggatatactgctttatggaaacatagtgtttgaaacgcaaaac
cttacgattccacactacgatcttttgaaccgccagtttttcctagtacctttagtcgaa
ctaaaggttttccatcatcctgttgaaggagatttttccttgaagctgaaagaaggtgaa
gaatgcaagcttttgacgagcaactggtga

DBGET integrated database retrieval system