KEGG   Thermotoga thermarum: Theth_1439Help
Entry
Theth_1439        CDS       T01554                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tta  Thermotoga thermarum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Theth_1439
  Lipid metabolism
   00561 Glycerolipid metabolism
    Theth_1439
   00600 Sphingolipid metabolism
    Theth_1439
Enzymes [BR:tta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Theth_1439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1451281..1452726)
Genome map
AA seq 481 aa AA seqDB search
MASVKIAIIGAGSAVFSMRLVNDLCKTKGLAGSLVSLMDIDQKRLEGVYDLARRYVEELG
ADLKFEKTMDLEVALKDADFVINTALVGGHWYLEKVREISQKHGYYRGIDAQEFNMVSDY
YTISNFNQLKFFVDVARLMEKLCPKAWLLQTANPVFEGTNLIRRCSNIKVVGFCHGHYGV
HEMVEALGLDIEKVDWQVAGFNHAIWLNRFVVEGKNGYELLDKWIEKNSHTWKPKTPFDL
QLSPAAIDMYKFYGQLPIGDTPRNGSWKYNYNLEVKKKWYGEPWGGADSELGWKWYQDML
QATTNAIEYLQKNKFIKLLQLETYMKLAPEGIPEELKQQAKIFASPDKLSGEQHILFIDS
LVNNIPRRFVINVPNEGYIPQLPDGVVVEVPAIVDAKGWHVEKIEPPLTDRVVKYYLMPR
MMRMEMALDAIMNGDKDVLIEFLIRDPRTKSYEQAVAVIEEIMSLPGNEKMKEHYEKRIK
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggtgaaaattgccattattggtgctggcagtgcggttttttcgatgaggctt
gtgaatgatctttgtaaaaccaaaggcttagctggcagtttggtcagtctcatggacatc
gatcagaaacgacttgaaggtgtttacgatcttgccagaaggtatgttgaagaacttggt
gcagatttgaagtttgagaaaacaatggaccttgaggttgctttaaaagatgctgatttc
gtcataaacactgctttggttggagggcattggtaccttgaaaaggtaagggaaatcagc
caaaagcatggttattaccgtgggatagatgcacaagaattcaacatggtttcggactat
tacacgataagcaatttcaatcagttgaagttttttgttgacgttgcaaggcttatggag
aagttatgtccgaaggcgtggcttttacagactgcaaatcccgtctttgagggtacgaat
ttaataagaaggtgttcaaacataaaagttgttggattctgtcatgggcactatggggta
catgagatggttgaggcacttgggctagatatagagaaggtggactggcaggttgctggg
ttcaaccatgcgatatggttgaacaggtttgttgtggaagggaagaacggctatgaactt
ttggacaagtggatagaaaagaattctcacacatggaagccgaagacaccgtttgatttg
cagcttagtcctgctgcgatagacatgtacaaattttacggtcagcttccgataggagac
acgccgaggaatggttcgtggaagtacaactacaatttagaggttaagaagaaatggtac
ggtgaaccttggggaggagcggattcggagctagggtggaagtggtatcaagacatgctg
caggctacgacgaatgcgatagagtacttgcaaaagaacaagtttataaagttgctgcag
cttgagacgtacatgaagcttgcgccggaaggaatacctgaggagctgaagcaacaggcg
aagatatttgcatcgcctgacaagttgagtggcgagcagcacatactgttcatagattct
ttggttaacaacattccaagaaggtttgtgataaatgtgccgaacgagggctacataccg
cagttaccggatggggttgtggtggaggtacctgcgatagttgacgcgaaaggttggcac
gtagagaagatagaaccgccgttgacggacagagtggtgaagtactatttgatgccgagg
atgatgagaatggaaatggcattggatgcgataatgaacggagacaaggatgttttgatt
gaatttttaataagagatccaaggacgaagtcttacgaacaagctgttgcagtgatagag
gaaataatgtctttaccgggaaatgaaaagatgaaagaacactatgaaaaacgaatcaaa
ttatga

DBGET integrated database retrieval system