KEGG   Thermotoga thermarum: Theth_1593Help
Entry
Theth_1593        CDS       T01554                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tta  Thermotoga thermarum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Theth_1593
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Theth_1593
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Theth_1593
Enzymes [BR:tta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Theth_1593
Exosome [BR:tta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Theth_1593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1606139..1607428
Genome map
AA seq 429 aa AA seqDB search
MRKFLAVLLLVSLCFSVFALNVIYMIGDGMAANQILLASILEGKILNIMKMPYTGLTTTY
SYDSWVTDSAPAGTALASGFKTLNRAIGVLPNGEPVPSMIELAAERGFKTGIVVTCRVTH
ATPAAFYGHVTNRDDEFTLAEQLANSKVDVIMGGGYAWFLPTDAGGRRTDGKNLIEQMKA
RGYTYVTKKSELQSVKSDKLLALFAPSHLDAVPVRSGEQPTLDEMVAKALEILSSSGEPF
ILMVEGSQIDWACHANDVFWTWKEMIEFDNAVKVALDFAARNGNTLVVVTGDHETGGLSL
SNGGYTIEVEKARKVKGTADYFLSKVKLDDYETFKGQAMEFFGVEISQDEFNYVKNASNK
SYALSEVVSKKLRIGWTTHDHTAAPVPVFAFGPGAEQFVGFMDNTDVAKTIMKLLGLHTL
SFPKPVAAK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaagtttttggcggttcttttgctggttagtctgtgcttcagtgtcttcgcactc
aacgttatctacatgattggcgatgggatggcggcaaaccaaattcttctggcaagtatc
cttgaaggcaaaattctcaacatcatgaagatgccgtacaccggtctaactacaacctat
tcgtacgattcttgggtcaccgattcagctccagctggtacggcacttgcaagtggtttt
aaaactttaaacagagccataggagtccttccaaatggagaaccagttccaagcatgatt
gaacttgcggcagaacgtggttttaaaactggtattgttgtaacctgcagggtcactcac
gcaaccccagctgcattctatggtcatgttacaaacagagatgatgaattcacattggca
gaacaacttgcaaattcaaaggttgacgtcataatgggtgggggatacgcttggttctta
ccaaccgatgcaggtggaagaagaacggatggaaagaatttgatcgagcagatgaaagca
agagggtacacctatgtgaccaaaaagtctgaacttcaatcagtcaaatccgacaagctt
ttggcgttgtttgcaccaagtcatttggatgcagtgccagttagatcgggcgaacagcca
actttggacgaaatggttgcaaaagctttggaaattctttcttccagtggtgaaccattc
atcttgatggttgaaggctctcaaatcgattgggcttgccacgcaaacgacgttttctgg
acatggaaagaaatgatcgaatttgacaacgctgtaaaagttgcgctcgattttgctgca
aggaacggcaacacattggttgttgtcactggtgatcatgaaactggaggactttctctc
tcaaacggtggatatactattgaggttgaaaaagcaagaaaagttaaaggaacagctgat
tatttcctgagcaaggtgaagctcgacgactacgaaacatttaaggggcaagctatggaa
ttcttcggtgttgagatatctcaggacgaattcaactacgtcaagaatgcttctaacaag
tcttatgcgctaagcgaagtcgtcagcaagaaattgagaatcggttggacaacacacgat
cacactgctgcgcctgtgcctgtttttgcctttggacctggtgcagaacaatttgttggc
tttatggacaacaccgacgttgccaaaactatcatgaaacttcttggattgcatacacta
agttttccaaaaccagttgcagcaaaatag

DBGET integrated database retrieval system