KEGG   Thermotoga thermarum: Theth_1635Help
Entry
Theth_1635        CDS       T01554                                 

Definition
enod-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
tta  Thermotoga thermarum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1651463..1654996)
Genome map
AA seq 1177 aa AA seqDB search
MQRVLKLVTVLLIISNVVLAAVVANYDFETTYGDWRGRGAASIALSDAVAHGGSKSLYVS
GRTAGWHGASLDLTAVLKPTRQYKFEGWVYQNSGSDQVMIITMQRTYSGESRGWDRIAQV
VAPSGKWTKIEGTYTVRASADELLFYFESENATLDFYIDDVLIVDLTGAMIFDFEKDLGN
WQNRGAAKIELSSAVAHSGSKSLYISGRTSGWHGAQLVLTDILKPTRQYKFEGWVYQNSG
SDQPIIITMQRVYAGESRGWDRIATVTAPSGKWVKIEGVYTVRAPAEELVFYFESDNATL
DFYVDDVMIIDLSAPVGEAAAQFEFVAKFEDNLNGFAPFGRAELSRTDVVASEGKYSLKI
SGRALLYDGCIVDMTKFAKDLVDSNMMVIANVYHDCDEPKPFAFLLYTKTKKAENYSYIG
YKIAMPKTWSTAVGYFNLKADDYEKVAILIVSPNAVDYNFYIDNFQVLGRQKAAQVKIPP
DFGPVALKELFAEHFKIGVALPVRVFSNSMDVELITKHFNSMTAENEMKPESILRRDASG
KIYYDFTVADRYIEFAQKHGMVVRGHTLVWHSQTPEWFFKDEKGNLLSREAMIERMREYI
HTVVGRYRGKVYAWDVVNEAVDENQPDGLRRSLWYQVIGPDYIELAFKFAHEADPDALLF
YNDYNEYHQKKRDVIYNMVKNMKEKGIPIHGIGMQQHINIGTSIEQIEQAIALYATIPGI
VIEITELDVNIYRDNATKYEIPPIDLLIQQANFYRRLFEVYKKYSDVINNVTFWGLKDDY
SWLRGYPVRRNNWPLLFDENYNAKLAYWALVKPELIPASSKEGSIVPGEAIIAGTMDDSF
LQSPPIKIVVDGNDKLIARVIWGEDKLYIYADVYDATRNPDKDGVAIFVDPKNFKAPFLH
DQAAYVIFWYNREIEKSENVEVERFLGPAYRRYSVEAAISMPGVKFSRDQLIGFDIAVID
DGKWYSWSDTTNQQKFSTLAYGTLKLEGIKTGKAMYGTPVIDGEIDDIWNKAEELETDVV
VMGSLQNASAKFRVLWDEEYLYVLAIVKDPVLNKDNSNAWEQDSIEIFISETNHKTPPYR
DGDGQFRVNFTNQQSFGTGASAARFKTATKIVEGGYLVEAAVKWSVIKPQAGMTIGFDFQ
VNDANAQGRRVGILKWCDPTDNTWQNMSKVGNLILTK
NT seq 3534 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagggtattaaagcttgttacagtactgttgatcatctccaacgtggttcttgct
gccgttgtagcaaattacgattttgagacaacttatggagattggcgtgggcgaggtgct
gcaagcatagccttaagtgatgctgtcgcacatggcggatcgaaatccttgtacgtctcc
ggtagaacggcaggttggcacggggcttcacttgatttgacggcagttttaaagccaact
cgtcagtacaaatttgagggatgggtttatcaaaattctggatcagatcaagttatgata
attactatgcaaagaacttactctggtgaatctagaggatgggacagaattgcgcaagtt
gtcgcgccaagcggtaagtggacgaaaatcgaaggaacttacacggtgagagcttcagct
gatgagctgttgttctactttgaatcggaaaatgcaacgcttgatttctacattgacgac
gttttgatcgttgatctaacgggtgcgatgatctttgactttgaaaaagatcttggcaac
tggcaaaatcgtggtgctgcgaaaattgaactgagcagtgcagttgcccacagtggatcg
aaatcgctctatatttccggtagaaccagcggatggcatggtgcccaacttgtcttgact
gatattttgaaacccactcgccaatacaaattcgaaggatgggtctatcagaactctggc
tcagatcaaccaataattataaccatgcaaagagtttacgctggtgaatccagaggttgg
gacagaattgcaactgtcacagcgccaagcggaaaatgggtgaaaatcgagggagtctac
accgttagagcaccagcggaagaacttgtcttttacttcgaatccgacaatgccacattg
gatttctatgtagacgatgtgatgataatcgatctatcagctcctgttggagaggcagct
gctcaatttgaatttgtagcaaaatttgaggacaatctcaacggctttgcgccctttgga
agggcagaactttccagaacagatgtggttgcaagcgaaggaaaatactcgctgaaaatt
tcaggcagggctttactgtatgacggttgtattgtcgatatgacgaaattcgcaaaagac
ttggtagattccaacatgatggtcatagctaacgtataccacgactgtgatgaaccaaaa
ccgttcgcatttttactttacaccaaaaccaaaaaagctgaaaattattcgtacataggc
tacaaaatcgccatgccaaaaacttggtcaaccgctgttggatacttcaatctaaaagct
gacgactatgaaaaagtagctattctaatagtctcaccaaatgctgtggactataacttt
tacatcgataacttccaagtccttggtcgacaaaaagctgctcaagtcaaaatcccacct
gattttggacctgttgctttgaaagaactgtttgcagaacacttcaaaattggtgtcgct
ctaccagttagagttttcagcaattcgatggatgtggagttaattacgaagcactttaac
agtatgacggctgagaacgagatgaaaccagagagtatattgagaagggatgcgagtggg
aagatttactatgattttacggttgcagacaggtacatagagtttgcgcagaaacatggg
atggttgttaggggtcatacacttgtttggcacagtcagacgccggagtggtttttcaag
gatgagaagggcaatttattgagcagggaagcgatgatagagaggatgcgggagtacata
cacacagttgtaggcaggtatagaggcaaggtgtatgcgtgggatgtggtgaacgaggcg
gtggatgagaatcagcctgatggtttgaggaggagtttgtggtatcaggttatagggccg
gattacatagagcttgccttcaaatttgctcacgaagcagatccagatgccttgctcttc
tacaacgattacaacgaataccatcaaaagaaaagagatgtcatttacaacatggtgaag
aacatgaaagaaaaaggaatacccattcatggtataggtatgcagcagcacatcaacatc
ggaacaagcattgaacaaatagagcaagcgattgcgttatatgccactatacctggcatt
gtgattgagataactgaacttgacgtcaacatttacagagacaatgccacaaagtatgaa
atcccaccaatcgatcttttgatccagcaagccaacttttatcgcaggctctttgaagta
tacaaaaagtacagtgatgtcataaacaacgttactttctggggattgaaagacgattac
tcttggctcagaggatatcctgttagaagaaacaactggccattgctttttgacgaaaat
tacaatgcaaagcttgcttactgggcgcttgttaaaccagaattgattcccgcatcttca
aaggaaggatctatagtccctggtgaagcgataatagctggaacaatggatgattcattc
ttgcaatcgcctccaatcaaaatagttgtcgatggtaacgataaattgattgcacgagta
atatggggcgaagataaactgtacatctacgccgatgtgtacgacgcaactcgaaatccc
gacaaagatggtgttgcaatcttcgttgaccccaaaaacttcaaagctcctttcctccac
gatcaagcagcttacgtgatcttttggtacaacagggaaattgaaaaaagtgaaaacgtc
gaagtagaaagattccttggaccagcttacagaagatattctgttgaagcggccatctca
atgcctggtgtgaaattctcccgcgaccaattgataggctttgacatagccgtcatcgac
gatggaaaatggtacagctggtctgatacgacgaatcagcaaaagttctccacactcgct
tacggtacgttgaaactggagggtatcaaaacgggtaaagccatgtacggcacaccggtg
atagatggagaaatagacgatatctggaacaaagccgaggaacttgaaacagacgtcgtc
gtgatgggttcgttgcaaaatgcctctgcaaagtttagagtattgtgggatgaagaatat
ctgtacgtacttgcaattgtaaaagatcctgttttgaacaaagacaactccaacgcttgg
gaacaggattccattgagatattcatcagtgaaaccaaccacaagacaccaccgtaccgt
gatggtgatggacagttcagagtgaactttaccaaccagcaatccttcggaacaggagca
agtgccgcaagattcaaaacggcaaccaagatagtcgaaggtggctacctagttgaagct
gcagtaaaatggagcgttataaaaccacaagctggcatgaccataggctttgacttccag
gtgaacgacgcaaatgcccaaggaagaagagttggaatcttgaaatggtgtgatccaacg
gacaacacatggcagaacatgtcaaaggttggcaatttgatcctaacaaaataa

DBGET integrated database retrieval system