KEGG   Thermotoga thermarum: Theth_1636Help
Entry
Theth_1636        CDS       T01554                                 

Definition
enod-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
tta  Thermotoga thermarum
Brite
Enzymes [BR:tta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Theth_1636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1655017..1656111)
Genome map
AA seq 364 aa AA seqDB search
MKKLIFAITLLLIVFTVIIKGGPQPMSSQIPSLKDVFLQDFKIGVALPVRVFSNSMDVEL
ITKHFNSMTAENEMKPESILRRDASGKIYYDFTVADRYIEFAQKHGMVVRGHTLVWHSQT
PEWFFKDEKGNLLSREAMIERMREYIHTVVGRYRGKVYAWDVVNEAVDENQPDGLRRSLW
YQVIGPDYIELAFKFAHEADPDALLFYNDYNEFFPKKRDIIFKLVKEMREKGVPIHGIGM
QQHLTLADNVGWIDIAIQKFKTISGIQIHITELDVSVYKSRSPSIIYQTPPLEVLKEQAE
FYRKLFEIYRKHTDVITNVTFWGLKDDYSWLRFFFGRRNDWPLLFDENYQPKPAFWSVIE
SVSK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctgattttcgccatcacattgttgcttatagtctttactgtgataatcaaa
ggaggaccacagcccatgtcgtcacagataccatcccttaaggatgtttttttgcaggat
ttcaaaataggagtagctttaccagttagagttttcagcaattcgatggatgtggagtta
attacgaagcactttaacagtatgacggctgagaacgagatgaaaccagagagtatattg
agaagggatgcgagtgggaagatttactatgattttacggttgcagacaggtacatagag
tttgcgcagaaacatgggatggttgttaggggtcatacacttgtttggcacagtcagacg
ccggagtggtttttcaaggatgagaagggcaatttattgagcagggaagcgatgatagag
aggatgcgggagtacatacacacagttgtaggcaggtatagaggcaaggtgtatgcgtgg
gatgtggtgaacgaggcggtggatgagaatcagcctgatggtttgaggaggagtttgtgg
tatcaggttatagggccggattacatagagcttgccttcaaatttgctcacgaagcagat
ccagacgccttactcttctacaacgattacaacgaatttttccccaaaaagcgagacatc
atcttcaaattggtaaaagaaatgagagaaaagggtgtaccgattcatggtattggcatg
cagcaacatttaactcttgcagataacgtaggttggattgatattgctattcaaaaattc
aagaccatttcaggtatacaaattcacataactgagcttgatgttagtgtttacaaatca
cgcagtccatctattatctatcaaacgccacccttggaggtgctcaaggagcaagcggaa
ttttaccgcaagttgttcgaaatctataggaaacacactgacgtcataaccaacgttacc
ttctggggtttgaaagatgactattcgtggctaaggtttttctttggtcgtagaaacgat
tggccgcttttatttgacgaaaattatcaacccaaaccagctttttggagtgtaatagaa
tcagtttccaagtaa

DBGET integrated database retrieval system