KEGG   Thermotoga thermarum: Theth_1814Help
Entry
Theth_1814        CDS       T01554                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tta  Thermotoga thermarum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tta00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tta00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1836975..1838456
Genome map
AA seq 493 aa AA seqDB search
MLVRNIVAAIEGMVVNASLDGALDKEVLGLTNHSAQVKPGYVFICRKGSKFDSHELVPEV
AKRDPALIVMEKVVPCKVPHVIVPDSRLAEALIAAEFYNHPYKKLLTIGVTGTNGKTTCV
HLFHHVLKQLGLKGSMLGTVVYDILGEKPFHADNTTPDAIVTLSAMAKTVQRNGQYFAME
VSSHALAMKRVESIRFDIAGLTNITRDHLDYHQNFEDYVKTKLHIFDLLKDEGIAVISDE
YQHLLSKKVRKVVYGISTKSDYKILDMDVEKHKTKFRFSTKFGIFDCEINQPGVHFAYNA
SLVMAALMEIGYDPKAVVEAVKTFPGVEGRFQYVPEASLLGIEVVVDFAHSPDALEKTLI
TARKLSSGRVITVFGAGGQADKGKRPLMAEVVCKYSDITIITTDDPRGEDPEEILRQVEK
GVIPGCPYLLIPDRAEAIETALTIANRGDMVIVAGRGHEEYQIFSEEKKIPFKDADVIRE
LIKKVAGKGKDVA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgcgaaacattgttgcagcaatcgaaggaatggttgtgaatgcttcgctggat
ggggctttggacaaggaagttcttggtttaacgaatcattctgcacaggttaagccaggg
tatgtgttcatatgtcgcaagggtagcaagtttgattcgcacgagctggttcccgaggtg
gcaaagagagatcctgccttgatcgttatggaaaaagttgttccttgcaaagtcccacac
gtgattgttccagacagtagattagccgaagctttaattgcagctgaattttacaaccat
ccttacaaaaagcttttgacgatcggcgtaactggaacaaacggtaagacaacctgtgtc
cacttgtttcatcacgttctcaaacagttgggcttaaagggtagcatgttgggaacggtg
gtttacgacattttaggtgaaaaaccttttcatgccgacaacacaacgcctgatgcgatt
gtcacactgtctgcaatggccaaaactgtacaaagaaatggtcaatactttgcgatggaa
gtttcatctcatgctcttgcgatgaaaagggttgaaagcataagatttgatatagctggc
ttgacaaatataacaagggatcatttggattatcatcaaaactttgaagattacgtcaaa
accaaactccacatttttgatttgcttaaggatgaaggaatagctgttataagcgatgag
tatcaacatttgttgagcaaaaaggttaggaaagttgtctacggtatatcgactaaaagt
gattataaaattttggacatggatgtggaaaaacacaagacgaagttcagattttcaact
aaatttgggattttcgactgcgagatcaatcaaccaggggttcactttgcttacaatgct
tcacttgtgatggctgccttgatggaaatagggtacgatccaaaagcggttgttgaggca
gttaaaactttcccaggtgtcgagggaaggtttcaatacgttccagaggcaagtttgctt
ggaatagaagtagtcgtagattttgcacacagtcctgatgcacttgagaaaactttgata
accgcaagaaagctttcttctggaagagtgataacggtttttggtgcaggtgggcaagca
gataagggtaaaagacctttaatggcagaagtggtgtgcaagtactcggacataacgatc
atcacaactgacgatccaagaggggaagatccggaggaaattctgcgccaagttgaaaag
ggagttatcccaggttgtccttaccttttgataccagatagggctgaagccatcgaaact
gccttaacaattgccaaccgaggagatatggtaatagttgcaggtagagggcacgaggag
tatcaaattttcagcgaggaaaagaaaataccctttaaagatgctgatgtgataagagaa
cttataaaaaaagttgcagggaagggaaaagatgttgcttga

DBGET integrated database retrieval system