KEGG   Pseudothermotoga thermarum: Theth_1825Help
Entry
Theth_1825        CDS       T01554                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
tta  Pseudothermotoga thermarum
Pathway
tta00010  Glycolysis / Gluconeogenesis
tta00020  Citrate cycle (TCA cycle)
tta00620  Pyruvate metabolism
tta00640  Propanoate metabolism
tta00650  Butanoate metabolism
tta00680  Methane metabolism
tta01100  Metabolic pathways
tta01120  Microbial metabolism in diverse environments
tta01130  Biosynthesis of antibiotics
tta01200  Carbon metabolism
Module
tta_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theth_1825
   00020 Citrate cycle (TCA cycle)
    Theth_1825
   00620 Pyruvate metabolism
    Theth_1825
   00640 Propanoate metabolism
    Theth_1825
   00650 Butanoate metabolism
    Theth_1825
  Energy metabolism
   00680 Methane metabolism
    Theth_1825
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Theth_1825
Enzymes [BR:tta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Theth_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_16 Fer4_9 Fer4_7 Fer4_10 Fer4_2 Fer4_13 Fer4_4 Fer4_17 DUF4723 Fer4_15 Fer4_3 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AEH51867
UniProt: F7YW95
Position
1848651..1848953
Genome map
AA seq 100 aa AA seqDB search
MAELKGWKELPIAGLVIEPGTARKYKTGDWRVKRPVYDRSKCIDCMMCWFYCPDQAIIQE
NAVMKGINYFYCKGCGVCANVCPKKAIEMRPETEFITKEE
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaacttaaggggtggaaggaactgccaatagctggtctagtcatagaacctggc
acagctagaaaatataaaactggtgattggagagtcaaaagacctgtttatgatagatca
aaatgtatcgattgcatgatgtgctggttctattgtccagatcaagcgataatccaagag
aatgctgtgatgaagggaataaattatttctattgcaaaggttgtggagtttgtgcaaac
gtttgcccaaagaaagctatcgagatgagaccagagacagagtttataaccaaggaggaa
tga

DBGET integrated database retrieval system