KEGG   Thermotoga thermarum: Theth_1826Help
Entry
Theth_1826        CDS       T01554                                 

Definition
pyruvate ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
tta  Thermotoga thermarum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:tta01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tta00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tta00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tta00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tta00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tta00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:tta00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1848957..1850132
Genome map
AA seq 391 aa AA seqDB search
MAKKMIQAITGAEAAAYAMKQIEPDVVAAYPITPQTPIVEYYAKFVADGLVKTEMIPVES
EHSAMSAVVGAAAAGARAMTATSAVGLALMHEIVYIAASMRLPVVMHVVNRALSAPLNIH
CDHSDAMAERDSGWIQLYCENAQEVYDLTILAVRLAEHEDVRLPVMVNQDGFIISHGVEP
VELLPDEVVKAFVGELKPLYPLLDTDHPVTYGSLDLYDYYFEHKRQQIEAMKNVLKVFPQ
VAEEFYKISGRKYNFVEPYKMEDAQYVMVALGSTNGTIKYVVDELREKGHKVGLLKIWMF
RPFPKAEIQRWLTGRKAVVVLDRSVSFGAEAPLYEAIKSALYEAASRPLLGSFVYGLGGR
DINPDLIRYAFEKAMKHELVADQEMYLGLRE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaaatgattcaagcaataactggtgcggaagcagctgcttatgcaatgaag
caaatagaacctgatgttgttgcagcttatccgataactcctcaaacacctatcgttgaa
tattacgcaaaattcgttgccgatggtcttgtgaaaactgagatgattcctgttgaaagt
gagcatagtgccatgagtgctgttgttggagcagctgcggctggtgcaagggcgatgact
gccaccagtgctgttggtttggctttgatgcacgaaattgtttacatagctgcttccatg
cggttgccagtcgtcatgcacgttgtcaaccgcgctttgagtgccccgctaaacattcac
tgcgatcacagcgatgctatggcagaaagagattctggatggatacagctttattgtgaa
aatgcgcaagaagtctacgatttgacgattttagccgttagacttgcggagcatgaagac
gttaggcttcccgtgatggtcaaccaggatggatttataatctcgcacggtgttgaacct
gtggaacttttgccagacgaagttgtgaaagccttcgttggtgaattgaaacctttgtat
ccacttcttgacactgatcatcccgtcacctacggttctcttgatctttacgattactac
tttgagcacaaaaggcagcaaatagaagctatgaaaaatgtgcttaaagttttcccacaa
gttgcggaagagttttacaaaatatctggtagaaagtacaactttgttgagccatacaaa
atggaagatgctcagtatgtgatggtggctttgggttcaacgaatggtacgatcaagtat
gtggtcgatgagctcagagaaaaaggacacaaagttgggcttttgaagatatggatgttc
agaccgttcccgaaggcggaaatacaaagatggcttactggaagaaaagcagttgttgtt
cttgataggtcagtttcttttggagctgaagcaccgttgtacgaagcgataaaatctgcg
ctttacgaagctgcttctagacctttgcttggttcattcgtttacggcttgggtggaagg
gatatcaacccagatttgatcagatatgcattcgagaaagccatgaaacacgaactggtt
gcagatcaggaaatgtaccttggcctaagagaatag

DBGET integrated database retrieval system