KEGG   Pseudothermotoga thermarum: Theth_1881Help
Entry
Theth_1881        CDS       T01554                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tta  Pseudothermotoga thermarum
Pathway
tta00010  Glycolysis / Gluconeogenesis
tta00030  Pentose phosphate pathway
tta00051  Fructose and mannose metabolism
tta00052  Galactose metabolism
tta00680  Methane metabolism
tta01100  Metabolic pathways
tta01110  Biosynthesis of secondary metabolites
tta01120  Microbial metabolism in diverse environments
tta01130  Biosynthesis of antibiotics
tta01200  Carbon metabolism
tta01230  Biosynthesis of amino acids
tta03018  RNA degradation
Module
tta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theth_1881
   00030 Pentose phosphate pathway
    Theth_1881
   00051 Fructose and mannose metabolism
    Theth_1881
   00052 Galactose metabolism
    Theth_1881
  Energy metabolism
   00680 Methane metabolism
    Theth_1881
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Theth_1881
Enzymes [BR:tta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Theth_1881
Protein phosphatases and associated proteins [BR:tta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Theth_1881
Messenger RNA biogenesis [BR:tta03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Theth_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat DUF128
Motif
Other DBs
NCBI-ProteinID: AEH51922
UniProt: F7YWE4
Position
complement(1902838..1903797)
Genome map
AA seq 319 aa AA seqDB search
MKTIAVLTSGGDSPGMNAAIRAVVRVGIRSGLKVVGIERGYCGLIDGTFKEMTFASVAGI
TEKGGTILRTSRCGEFYTPEGRAKAAEQLKKAKIDGLVVIGGEGSLTGAKILHEEYGIPI
VGIPGTIDNDIAETDMCVGVDTCLNTVVDAIQKLKDTATSHERAFIVEVMGRESGYIALM
AAIATGAEAAVIPEIPIDYDKLAARLLEERKRGKINCIIVVAEGAGGAINVAKNLQDKIG
YETRISILGHIQRGGSPSAFDRLLATRMGAEAVKALLDGEKCVMIGLKMGKMVRVSLEKV
IGRKKELDLSLYDLALILS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatagccgttttgacaagcggaggagattcgcctggaatgaacgcagcgata
agagctgtcgttcgggttggcataagaagcggtttaaaagtcgttggaatagagcgggga
tactgtggtttgatagatggaactttcaaagaaatgacttttgcttccgtcgcaggaatt
acggaaaagggcggtaccattcttcgaacaagtcgttgcggtgaattctacactcccgaa
ggaagagcgaaggctgctgaacagctgaaaaaagcaaaaatagatggactagttgtaata
ggtggagaaggaagtttaacaggcgcaaaaattcttcacgaagaatacggcataccgatt
gttgggataccaggaacaatagacaacgacatagccgaaaccgatatgtgcgtcggtgtt
gatacgtgtttaaacactgtggttgatgcgatacaaaagttgaaagacactgccacttct
cacgaaagagctttcatcgtggaagtcatgggaagagaatcaggttacatagcgctgatg
gctgcaattgcaactggagcagaagctgccgttatacccgagataccgatcgattacgat
aaactggcggcgagattgcttgaggaaagaaagaggggtaagataaactgcataatcgtt
gttgcagaaggtgctggcggagcaatcaacgttgccaaaaaccttcaagacaaaataggt
tatgaaacaaggatttctattcttggtcatatacaacgcggtggtagtccgagcgctttt
gacaggcttcttgccacaagaatgggtgcagaagccgtgaaagcgctcttggacggagaa
aaatgcgtgatgatcggtttaaaaatgggaaaaatggtcagggtatctttggaaaaagtg
ataggcagaaaaaaggagcttgacctatccttgtacgatctggctttgatcctatcctga

DBGET integrated database retrieval system