KEGG   Thermotoga thermarum: Theth_1889Help
Entry
Theth_1889        CDS       T01554                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tta  Thermotoga thermarum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theth_1889
   01230 Biosynthesis of amino acids
    Theth_1889
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theth_1889
   00030 Pentose phosphate pathway
    Theth_1889
   00051 Fructose and mannose metabolism
    Theth_1889
   00052 Galactose metabolism
    Theth_1889
  Energy metabolism
   00680 Methane metabolism
    Theth_1889
Enzymes [BR:tta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Theth_1889
Protein phosphatases and associated proteins [BR:tta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Theth_1889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1909776..1911038)
Genome map
AA seq 420 aa AA seqDB search
MAEKLGILVGGGPAPGINSVINAVTIAAITSGVDVVGIYDGFEHLMKGRTDMVRPLTISD
VSRIHTEGGSILRTSRANPTKNPEDLERAVKALKELNIRYLVTIGGDDTAFSASAVSKAS
NHEIYVAHVPKTIDNDLPLPGDMPTFGYETARHVGAELVYNLMQDSRTTNRWYFVVVMGR
RAGHLALGIGMSASATLTLIGEEFRKDKITLAEVCDVLEAAIIKRRILGRKDGVAVIAEG
IGELIDPKEFEQIPGVVVERDPHGHIRLSEIPLATILKREIQKRFEQRGEKITIVDVTLG
YELRCARPIPFDIDYTRTLGYGAVRFLLNEASPEKPGGLVCLDQGRIRIMPFEELIDPKT
GRTKVRLVDLESERYKVARKYMIRLTKQDLEDPVTLRNLAAAAKMSAEEFVRKFSAAAEI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaaaagcttgggattttagttggtggtggaccggcacctggtatcaacagtgtt
ataaacgccgttacgattgccgccatcacaagtggtgttgatgttgttggaatctacgat
gggtttgaacatctcatgaaaggcagaaccgacatggttcgacctttgaccatttccgat
gtctcgcgaatccataccgaaggtggatcaatacttcgaacttccagagccaatccaaca
aaaaatccggaagatttggaaagagcggttaaagctttaaaagaacttaacattcgctac
cttgtcacaattggtggggatgacacggctttctccgcttcagccgtttctaaggcaagc
aaccacgaaatatacgttgcacatgtcccaaaaacaatagacaacgatttgcctcttcca
ggggacatgccaaccttcggttatgaaactgctagacacgttggagcagaacttgtttac
aacctgatgcaagattcaagaacaaccaaccgctggtatttcgtcgtagtcatgggaaga
agggcaggacaccttgcacttgggataggaatgtctgcaagcgccactttgaccttgata
ggagaggaattcagaaaagataaaataaccttggccgaggtttgcgacgtccttgaagcg
gcgataataaaaagaagaattcttggaagaaaagatggtgtagcggtcatcgcagaaggt
ataggagaattaatagatccaaaagagtttgagcaaataccaggagttgtcgttgaaaga
gatccccatggtcacataagactctctgaaattccacttgccaccattctcaaaagagaa
attcaaaaacgctttgaacaaaggggagaaaaaataacaatagtcgatgtgacacttggc
tatgagctaagatgcgcaagaccaattccgtttgacatcgattacacaaggacacttggc
tatggtgccgttagatttctcttgaacgaagcttcacctgaaaaacctggtggattggtt
tgtttggaccaaggccgcataagaattatgccctttgaagaactgatcgatccaaaaact
ggtagaacaaaagtcaggttggtcgatctggaatcagaacgctacaaagttgctcgaaaa
tacatgatcaggctaacaaagcaagatcttgaagatccagttacgcttagaaaccttgcg
gcagcggcaaaaatgagcgcagaagagttcgtcagaaaattctcggcagctgcggaaatc
tag

DBGET integrated database retrieval system