KEGG   Thermotoga thermarum: Theth_1894Help
Entry
Theth_1894        CDS       T01554                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tta  Thermotoga thermarum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theth_1894
   01230 Biosynthesis of amino acids
    Theth_1894
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theth_1894
   00030 Pentose phosphate pathway
    Theth_1894
   00051 Fructose and mannose metabolism
    Theth_1894
   00052 Galactose metabolism
    Theth_1894
  Energy metabolism
   00680 Methane metabolism
    Theth_1894
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Theth_1894
Enzymes [BR:tta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Theth_1894
Protein phosphatases and associated proteins [BR:tta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Theth_1894
Messenger RNA biogenesis [BR:tta03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Theth_1894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1916412..1917422
Genome map
AA seq 336 aa AA seqDB search
MRRIAILCVGNDCPGLNAAIRATVVKSNMEDLEVVGVKDGFEGLLRDQLDVLTRNSVSGI
LHRGGTILGTSLYIPESDEEVNKVVEKVKQYSITCLLILGGRIGTRAALRLMKANVPSIL
IPATIDNDLPFTDFSIGFFTAVSHVTDALDMLHSTAEAHHRVMIVETMGRPSGWIATVGG
LAGGADYVITNAEGFKAEDLLAKIRSRYEGHKRFSIVVVEDGLKLDQKFYEEVGVTQETP
PAKVIGMYIQKALKDINIEWRYTSLGYLQRGGSPVSMDRIIATMMATRAVEMVKAARVYH
AVGMRGFTVTEVPYSESMLNLKIVDEYLRNLAKLFY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaatagctattttgtgcgttggtaacgattgcccaggtttaaacgcagccata
agggctactgttgtgaaaagcaatatggaagatttagaggttgttggagtaaaagatggt
tttgaagggcttttgagagatcaactggatgttttaaccagaaacagtgtttcaggaata
cttcacagaggtggaactattttgggcacttctttgtacattccagaaagcgatgaggaa
gtgaacaaggtcgttgaaaaggtcaaacaatattccataacttgtttgctgatactcggt
ggcaggattggaacaagagccgcgttgagattgatgaaggccaacgtaccatcgattttg
attccagccacgatagacaacgatttgccgttcacagatttttcaataggtttcttcaca
gccgtcagccatgtcactgacgctttggatatgttgcattccacagccgaagcacatcac
agggttatgatagtcgaaacgatgggcagaccaagtggatggatagccactgttggagga
cttgcaggtggggcagattatgttataacaaatgcggaaggttttaaagcagaggatttg
ttggcgaagataaggtcacgttatgaagggcacaaaaggttctcgatagttgtggttgaa
gatgggttgaaattggaccaaaagttttacgaagaagttggcgtgacgcaagaaacacct
ccagctaaggtcataggaatgtacattcaaaaagctttgaaagatatcaacattgaatgg
cgttacaccagccttggatatctacaaaggggaggaagtcctgtcagcatggacaggata
atagcaaccatgatggcaactagagctgttgaaatggttaaagcagccagggtttatcac
gcagttggaatgagaggttttacagttaccgaagtaccgtattctgaaagcatgctcaac
ttgaagattgtagacgaatatttgagaaatcttgcaaaacttttctactga

DBGET integrated database retrieval system