KEGG   Pseudothermotoga thermarum: Theth_1894Help
Entry
Theth_1894        CDS       T01554                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tta  Pseudothermotoga thermarum
Pathway
tta00010  Glycolysis / Gluconeogenesis
tta00030  Pentose phosphate pathway
tta00051  Fructose and mannose metabolism
tta00052  Galactose metabolism
tta00680  Methane metabolism
tta01100  Metabolic pathways
tta01110  Biosynthesis of secondary metabolites
tta01120  Microbial metabolism in diverse environments
tta01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theth_1894
   00030 Pentose phosphate pathway
    Theth_1894
   00051 Fructose and mannose metabolism
    Theth_1894
   00052 Galactose metabolism
    Theth_1894
  Energy metabolism
   00680 Methane metabolism
    Theth_1894
Enzymes [BR:tta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Theth_1894
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Theth_1894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEH51935
UniProt: F7YWF7
Position
1916412..1917422
Genome map
AA seq 336 aa AA seqDB search
MRRIAILCVGNDCPGLNAAIRATVVKSNMEDLEVVGVKDGFEGLLRDQLDVLTRNSVSGI
LHRGGTILGTSLYIPESDEEVNKVVEKVKQYSITCLLILGGRIGTRAALRLMKANVPSIL
IPATIDNDLPFTDFSIGFFTAVSHVTDALDMLHSTAEAHHRVMIVETMGRPSGWIATVGG
LAGGADYVITNAEGFKAEDLLAKIRSRYEGHKRFSIVVVEDGLKLDQKFYEEVGVTQETP
PAKVIGMYIQKALKDINIEWRYTSLGYLQRGGSPVSMDRIIATMMATRAVEMVKAARVYH
AVGMRGFTVTEVPYSESMLNLKIVDEYLRNLAKLFY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaatagctattttgtgcgttggtaacgattgcccaggtttaaacgcagccata
agggctactgttgtgaaaagcaatatggaagatttagaggttgttggagtaaaagatggt
tttgaagggcttttgagagatcaactggatgttttaaccagaaacagtgtttcaggaata
cttcacagaggtggaactattttgggcacttctttgtacattccagaaagcgatgaggaa
gtgaacaaggtcgttgaaaaggtcaaacaatattccataacttgtttgctgatactcggt
ggcaggattggaacaagagccgcgttgagattgatgaaggccaacgtaccatcgattttg
attccagccacgatagacaacgatttgccgttcacagatttttcaataggtttcttcaca
gccgtcagccatgtcactgacgctttggatatgttgcattccacagccgaagcacatcac
agggttatgatagtcgaaacgatgggcagaccaagtggatggatagccactgttggagga
cttgcaggtggggcagattatgttataacaaatgcggaaggttttaaagcagaggatttg
ttggcgaagataaggtcacgttatgaagggcacaaaaggttctcgatagttgtggttgaa
gatgggttgaaattggaccaaaagttttacgaagaagttggcgtgacgcaagaaacacct
ccagctaaggtcataggaatgtacattcaaaaagctttgaaagatatcaacattgaatgg
cgttacaccagccttggatatctacaaaggggaggaagtcctgtcagcatggacaggata
atagcaaccatgatggcaactagagctgttgaaatggttaaagcagccagggtttatcac
gcagttggaatgagaggttttacagttaccgaagtaccgtattctgaaagcatgctcaac
ttgaagattgtagacgaatatttgagaaatcttgcaaaacttttctactga

DBGET integrated database retrieval system