KEGG   Thermoanaerobacter tengcongensis: TTE0061Help
Entry
TTE0061           CDS       T00081                                 

Definition
hypothetical protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tte00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tte00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tte00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
67652..69565
Genome map
AA seq 637 aa AA seqDB search
MNRKSNGGDEMDIFKRTFILGANYWPRNHGIEMWKEWNYEEIKKEFIEAKNLGLNVMRIN
LFWEDFQPQPDVISEEAIQKFDELIKICNEVDMRIAPTFFVGHMSGENWDVPWREGKNIY
SDSYMLRYQLKLVRFFAERYKDQDAILFWDLSNEPDNYVKANSRHDAWLWNYVLSNEIKK
YDKKHPVTLGIHQASLLTNNNFYPEDMAEGNDFLCMHFYPIYTDVCLDPVNSTRSTYMAP
FSVKLTKGMGKKDVLMEEFGATTLMMGEEVEGDYYRVVLYSLLANGSIGAIAWCFGDFSV
GKRLPYNSTPFETQFGITTVEGRPKKAALEMKAFSEFLREVEYEKLRPKESDAAIIIPDK
YYEALFVGKDYTPERNFRILLNSFILAKQAGLDVDLIRPEDDFKKYKLLIVPSAYRKGHL
TYSQWLKVMEFVKEGGTLYLSYDGIAIEGFEEVFGVKIEYFMVPREENVEIESEILPARL
EFKALPSNKRLILKPIKGETIAKDKEGNPSIIVNQYGKGRAILVTYPIELYLSYMPDVYK
SNESFKIYQLAKRLAGIVYEVEVDSPYVEVKEFNFENRKLILLINHENEEVRIGVKLKDK
GRFNEKIEDLVNKREINPENFAIAPNGVVAFWLKKGV
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
ttgaacagaaaaagtaatggaggagatgagatggatatcttcaaaagaacctttatccta
ggagctaattactggccaagaaatcacgggattgaaatgtggaaagagtggaattatgag
gagataaaaaaggaatttatagaagccaaaaacttggggcttaatgtcatgaggataaat
cttttttgggaggattttcaacctcagccggatgtaatttctgaagaagccatacaaaaa
tttgacgagcttataaaaatatgcaatgaagtagacatgagaattgctcccacttttttt
gtgggacatatgagcggagagaattgggatgttccgtggcgggaaggaaaaaatatatac
agcgattcttacatgctaagataccagctcaagctagtgaggttttttgccgaaagatat
aaagatcaagatgctatcctgttttgggacctgtcaaatgagccagacaactacgtaaaa
gcaaattcaaggcatgatgcgtggctttggaattatgttttgtcaaatgagataaaaaag
tatgacaaaaaacatcctgtgacgctgggaattcaccaagcttcccttcttacaaataat
aatttctatccagaagacatggcggaaggaaatgattttctgtgtatgcatttttatccc
atatacacagatgtttgtttagaccctgtcaactctacaagaagcacttatatggctcct
ttttctgtgaaattgactaaagggatggggaaaaaagatgttttaatggaggaatttgga
gctacaaccttgatgatgggagaagaggtagaaggggattattacagggtagtgctatac
agtcttctggcaaatggatctatcggtgctattgcctggtgttttggggatttttctgta
ggaaaaagactaccttataattctactccttttgaaactcaatttggcattactacagtg
gagggcagacctaaaaaagctgctcttgagatgaaggcattttctgaatttttaagggaa
gtagaatatgagaagttaagacctaaggaaagcgatgcagcgattataattcctgataaa
tactatgaagctttgtttgtggggaaagattacacgccggagaggaattttagaatttta
ctcaatagctttatattggcaaaacaagcaggacttgatgtggacttgataagaccggag
gatgattttaaaaagtataaactcttgatagtgccatctgcctataggaaggggcatttg
acttactcccaatggcttaaggtcatggagtttgtcaaagaaggtgggactctctacctt
tcttacgatggaatcgctattgaaggttttgaagaggtttttggcgtaaaaatagaatat
ttcatggtgccaagagaggaaaatgtagaaattgaatcagaaattttgcctgctaggctt
gagtttaaggctttaccttctaacaaaaggcttattttaaagccgataaaaggagaaaca
atagcaaaagataaagaaggcaatccttcaataatagtaaatcagtatggaaaaggaaga
gcaattcttgtgacctatccaatagagctttatctaagttacatgccagatgtatataag
agcaatgaatcttttaagatttatcaacttgcaaaaagattagctggcattgtttatgaa
gtggaggtagattcgccgtatgtggaagtaaaagaatttaactttgaaaacagaaaatta
attttgcttataaaccacgaaaatgaggaggtgaggattggggtaaaattaaaagataaa
gggaggtttaatgagaaaattgaagatttagtgaataaaagagagattaaccctgaaaac
ttcgctatagcacccaatggagtagttgcattttggcttaaaaagggggtataa

DBGET integrated database retrieval system