KEGG   Thermoanaerobacter tengcongensis: TTE0061Help
Entry
TTE0061           CDS       T00081                                 

Definition
hypothetical protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TTE0061
  Lipid metabolism
   00600 Sphingolipid metabolism
    TTE0061
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TTE0061
Enzymes [BR:tte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TTE0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
67652..69565
Genome map
AA seq 637 aa AA seqDB search
MNRKSNGGDEMDIFKRTFILGANYWPRNHGIEMWKEWNYEEIKKEFIEAKNLGLNVMRIN
LFWEDFQPQPDVISEEAIQKFDELIKICNEVDMRIAPTFFVGHMSGENWDVPWREGKNIY
SDSYMLRYQLKLVRFFAERYKDQDAILFWDLSNEPDNYVKANSRHDAWLWNYVLSNEIKK
YDKKHPVTLGIHQASLLTNNNFYPEDMAEGNDFLCMHFYPIYTDVCLDPVNSTRSTYMAP
FSVKLTKGMGKKDVLMEEFGATTLMMGEEVEGDYYRVVLYSLLANGSIGAIAWCFGDFSV
GKRLPYNSTPFETQFGITTVEGRPKKAALEMKAFSEFLREVEYEKLRPKESDAAIIIPDK
YYEALFVGKDYTPERNFRILLNSFILAKQAGLDVDLIRPEDDFKKYKLLIVPSAYRKGHL
TYSQWLKVMEFVKEGGTLYLSYDGIAIEGFEEVFGVKIEYFMVPREENVEIESEILPARL
EFKALPSNKRLILKPIKGETIAKDKEGNPSIIVNQYGKGRAILVTYPIELYLSYMPDVYK
SNESFKIYQLAKRLAGIVYEVEVDSPYVEVKEFNFENRKLILLINHENEEVRIGVKLKDK
GRFNEKIEDLVNKREINPENFAIAPNGVVAFWLKKGV
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
ttgaacagaaaaagtaatggaggagatgagatggatatcttcaaaagaacctttatccta
ggagctaattactggccaagaaatcacgggattgaaatgtggaaagagtggaattatgag
gagataaaaaaggaatttatagaagccaaaaacttggggcttaatgtcatgaggataaat
cttttttgggaggattttcaacctcagccggatgtaatttctgaagaagccatacaaaaa
tttgacgagcttataaaaatatgcaatgaagtagacatgagaattgctcccacttttttt
gtgggacatatgagcggagagaattgggatgttccgtggcgggaaggaaaaaatatatac
agcgattcttacatgctaagataccagctcaagctagtgaggttttttgccgaaagatat
aaagatcaagatgctatcctgttttgggacctgtcaaatgagccagacaactacgtaaaa
gcaaattcaaggcatgatgcgtggctttggaattatgttttgtcaaatgagataaaaaag
tatgacaaaaaacatcctgtgacgctgggaattcaccaagcttcccttcttacaaataat
aatttctatccagaagacatggcggaaggaaatgattttctgtgtatgcatttttatccc
atatacacagatgtttgtttagaccctgtcaactctacaagaagcacttatatggctcct
ttttctgtgaaattgactaaagggatggggaaaaaagatgttttaatggaggaatttgga
gctacaaccttgatgatgggagaagaggtagaaggggattattacagggtagtgctatac
agtcttctggcaaatggatctatcggtgctattgcctggtgttttggggatttttctgta
ggaaaaagactaccttataattctactccttttgaaactcaatttggcattactacagtg
gagggcagacctaaaaaagctgctcttgagatgaaggcattttctgaatttttaagggaa
gtagaatatgagaagttaagacctaaggaaagcgatgcagcgattataattcctgataaa
tactatgaagctttgtttgtggggaaagattacacgccggagaggaattttagaatttta
ctcaatagctttatattggcaaaacaagcaggacttgatgtggacttgataagaccggag
gatgattttaaaaagtataaactcttgatagtgccatctgcctataggaaggggcatttg
acttactcccaatggcttaaggtcatggagtttgtcaaagaaggtgggactctctacctt
tcttacgatggaatcgctattgaaggttttgaagaggtttttggcgtaaaaatagaatat
ttcatggtgccaagagaggaaaatgtagaaattgaatcagaaattttgcctgctaggctt
gagtttaaggctttaccttctaacaaaaggcttattttaaagccgataaaaggagaaaca
atagcaaaagataaagaaggcaatccttcaataatagtaaatcagtatggaaaaggaaga
gcaattcttgtgacctatccaatagagctttatctaagttacatgccagatgtatataag
agcaatgaatcttttaagatttatcaacttgcaaaaagattagctggcattgtttatgaa
gtggaggtagattcgccgtatgtggaagtaaaagaatttaactttgaaaacagaaaatta
attttgcttataaaccacgaaaatgaggaggtgaggattggggtaaaattaaaagataaa
gggaggtttaatgagaaaattgaagatttagtgaataaaagagagattaaccctgaaaac
ttcgctatagcacccaatggagtagttgcattttggcttaaaaagggggtataa

DBGET integrated database retrieval system