KEGG   Thermoanaerobacter tengcongensis: TTE0158Help
Entry
TTE0158           CDS       T00081                                 

Gene name
MurA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tte00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tte00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
153997..155244
Genome map
AA seq 415 aa AA seqDB search
MKTKFVVEKSPPLKGTVKISGAKNSVLPIIAASLLSSDEVILEDIPSLEDVNVMIELIKN
FGALCELDNGKLKIKVDIKDVEAPYELVKKMRASFLVMGPILAKLGHAKISMPGGCAIGA
RPIDLHLKGFQSLGADITIGHGYVEARAKKLTGKKIYLDFPSVGATENIMMAAVFADGVT
VIENAAEEPEIVDLANFLNKMGANIKGAGTDTIRIEGVKELKGAEHTVIPDRIEAGTFMV
AAAMTGGNVLIENVIVDHVRSVIAKLTECGVKITEEKGGLRVKGVKNYKAVDIKTLPYPG
FPTDMQAQMMAMMTVAKGTSVIIETVFENRFMHVSELKRMGANIKIEGRSAMITGVDHLT
GAEVKATDLRAGAALVLAGLIAEGRTEINDIYHVDRGYVKMEEKLRALGAKIYRK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgaaatttgttgttgaaaaaagcccgccccttaaaggaacggttaagataagc
ggtgcgaagaattcggttttgcctataattgctgcttcactgctttcatctgatgaagtg
atattagaagatataccctctctggaagacgtcaatgtaatgatagaactcataaagaat
tttggagccctgtgtgagttggacaatgggaaattgaagataaaggtagatataaaggac
gtagaagcgccttatgaacttgttaaaaagatgagggcatcctttttggtgatgggaccc
atactggcaaagctgggacatgccaaaatttccatgcctggaggttgtgcaataggggct
cgacctatagacctacatttaaaggggtttcaaagtctgggagctgatataactatcgga
cacggatatgttgaggcaagagctaaaaaattgacaggcaaaaagatataccttgatttt
cccagtgtaggagcaactgagaatataatgatggctgcagtttttgccgacggtgttact
gtaattgaaaatgctgctgaggagcctgagattgtggatttggcgaattttttgaacaag
atgggggccaatatcaaaggagcaggtactgacactatacgaattgaaggagtaaaggaa
ttgaaaggagcagaacacactgtcatacctgatagaattgaagcaggaacttttatggtg
gcagcggccatgacaggcgggaatgtgctcattgaaaatgtgatagtggaccatgtgagg
tctgtaattgcaaaattgacagaatgcggagttaagataacggaagaaaagggaggcctc
agggtaaaaggggtaaaaaattacaaggctgttgacataaagacccttccatatccggga
tttccaacggacatgcaagcgcagatgatggccatgatgaccgtggcaaagggtaccagc
gtcataatagagacagtttttgaaaacagatttatgcatgtgagcgaattaaagagaatg
ggcgcaaatataaaaattgagggcagaagtgcaatgattacaggtgtagaccatttgaca
ggagccgaagtgaaagctactgatttgagggcaggagcagctttggtgctggcagggctt
atagcagaggggagaacagagattaacgatatctaccatgtagacagaggatatgtgaag
atggaagagaagttaagagctctgggtgcaaaaatatacagaaaatag

DBGET integrated database retrieval system